Conserved Protein Domain Family
Sec34

?
pfam04136: Sec34 
Sec34-like family
Sec34 and Sec35 form a sub-complex, in a seven protein complex that includes Dor1 (pfam04124). This complex is thought to be important for tethering vesicles to the Golgi.
Statistics
?
PSSM-Id: 398005
Aligned: 101 rows
Threshold Bit Score: 118.756
Threshold Setting Gi: 123485398
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013934077 109 FQNYLRYNYEENKQFLKETNAIIQDLNKLLVIGDQVTLQTVDFQKKSTQLIVEIEQLNRLHENISSNLTLFESLDPIVQT 188  Ogataea parapo...
XP_009028436  99 YATILSEWIAECNKFLEEADSNLEMLTILKTDFIKVATKTNLLHEACEILLDEQSKCVQAVELINDQLVVFKECETVHQK 178  Helobdella rob...
OWR43308      91 YQKQLEDRRNECIALTDQINATMLDLDKLTNEYNLVSNKTNALHTMSEQLLSDQNKLTEIGEDIKQKLHYFTQVEHLAQR 170  Danaus plexipp...
EDS29041     113 YYEQLRARSAECDNLLGEIDVSLESLKKLTNEYNFVSEKTSSLHQASENLLQDQTRLNEIGEDIRKRLKYFTQAESISQR 192  southern house...
ETN62947     117 YYEQLRSRASECDTMLQEIDESLGSLRKLTQEFNFVSEKTSSLHQASESLLQDQTKLSDSGEEIRKRLKYFSQAESISQR 196  Anopheles darl...
Q7Q291       120 YYEQLRARTSECDQMVQEIDVSLDSLRQLTQEFNFVSEKTASLHQASESLLQDQARLSDTGEEIKKRLKYFTQAESISQR 199  Anopheles gamb...
Q961G1       117 YLQQLEQRKAECSHMLDQIAGAMERLGALCDEYDFVSQKTSALNTASEQLIEEQERLQELSHEIQRRLHYFSQVELLNQR 196  fruit fly
6_pfamImport   1 YLQQLKVRSGECDEILEEIDTAIEKLGNLQEEYDFVSNKTSALNSASEKLTEEQGILHEMSEEIQKRLHFFNQVETLTQR 80  
XP_028028325  95 YYKQLEDRRNECISLNEQINEAMSDLHKLTEQYNFVSNKTNALHNMSEQLLADQNKLSGIGDDIKKRLHYFTQVEHLSQR 174  wild silkworm
XP_016845689 100 YLGQLKARRAECHELCMEIERVLDDLALLSKQYTSVSEKTTSLHTASEQLTSDQEKLITFVEKIAEHIKYFKEVDFIMDK 179  jewel wasp
XP_013934077 189 LNTSSSGsiVAKDSFRhDILEELDRCLIFVHdpKHSTFKEIGIYKHRFK-QCMIRALTLVKNYITTAIRDL 258  Ogataea parapolymorpha ...
XP_009028436 179 INSPTFN--VQSEHFS-STLYRIDECIDYLK--AHEHFKESTAYLEKFQ-NYLVCCLRLLKNYVFNTFETV 243  Helobdella robusta
OWR43308     171 LNSSTMS--VNSETFF-NVLSKIDECLDYMR--ANSSFKEAQVYSFKYR-HLQNRAISLIQNYVNNVLNHA 235  Danaus plexippus plexippus
EDS29041     193 LQNPTFS--VSNDTFV-DILNTIDDCLEYMR--ANPTFSEASAYGIKYR-NCLSKATQMMKNYVSNVLANA 257  southern house mosquito
ETN62947     197 LHNPTVS--VSNESFA-DVLNTIDDCIEYMR--VNPTFCEASAYSIKYR-TCLAKAAQMMKVYVTNILANA 261  Anopheles darlingi
Q7Q291       200 LHNPTFS--VSNETFV-DMLNTIDDCLEYMR--TNPTFSEATAYAVKYR-ACLSKATQMMKAYVLGILSNA 264  Anopheles gambiae str. ...
Q961G1       197 LQSPTLS--VASEAFR-ECLNKIDECLNYIE--ENPKFKDAAAYNVKYR-QCLAKASGLVRNYVTSVINQA 261  fruit fly
6_pfamImport  81 LQSPTMS--VSSDAFK-DCLNRIDECLEYLK--ANPKFKESGIYIVKYRnHCLSKALSLIRTYVTNVLSQA 146 
XP_028028325 175 LNSPTMS--VNSDAFF-NVLAKIDECLDYMR--ENSNYKESHTYLVKYR-HLQNRAISVIRSYVNHVLDHA 239  wild silkworm
XP_016845689 180 LDAPTLS--VNSEIFF-NLLNKIDNNMDFMQ--NNPSFKESNTYLVKYR-HCQSKAITLIQNYIFKLFTRA 244  jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap