Conserved Protein Domain Family
Vps55

?
pfam04133: Vps55 
Vacuolar protein sorting 55
Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase. Both Vps55 and obesity receptor gene-related protein are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells.
Statistics
?
PSSM-Id: 398002
Aligned: 114 rows
Threshold Bit Score: 57.9106
Threshold Setting Gi: 74831897
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDK42066       7 IIFLSAFLASGFLLILLSCAL-------YN-N-YKPLWVIFIFLMAPLPNILANSiEAQR--DynfltfnDygnaqdlNL 75  Lodderomyces el...
EAY11791       7 yIVIGIFGTIALVLFIAGCAI-------TK-T-WWPLFGIIPATLSCIFGVSLSTkLGDDyve-------------dtEG 64  Trichomonas vag...
XP_001320939   7 yIVIGIFGTIALVLYIAGCAI-------TK-Q-WWPLFGIIPATLSCIFGISLSTkMGDDyve-------------dtEG 64  Trichomonas vag...
XP_001330722   6 yIILGIALTLGVTLIIVGCVT-------AK-N-AFALLELIPACVISFSYISYINkEDDSddD----------------- 59  Trichomonas vag...
EAY07081       7 yIALGVFLAIELALVIISCVL-------DK-N-AYALIIIVPLCFAIICQFLADSySDGYheE-------G--------- 61  Trichomonas vag...
XP_001565648   7 LIISAFCLVMGFLFLILGCTMv------KKrN-AWPLMSLVLYCFTPVPFVLCGRgAGSDefGgdd-depL--------- 69  Leishmania braz...
Q4Q9Q1         7 LIISAFFLVMGFLFLILGCTVv------KKrN-AWPLMSLAFYCFAPVPFFLCGRgADSDdfNdfd-depL--------- 69  Leishmania major
Q57ZB6         7 LVLSASLVVVAVVLSILACTVv------AGsN-VLPLFSLLLSFITPLPFLFFGRsESTFddD----------------- 62  Trypanosoma brucei
Q8MMD0         7 LFICAFLTCIGVTFLILACAV-------PTtKiFYPFFVLLFYVLSVLPVFIARRtTPGN------------------ET 61  fruit fly
EFC36584      11 LVAVAAGVSIGVMLAIIGCAVtwggvehPE-N-WFALITVLCYIIAPFPDIIARAfSSRFekEdp---edA--------- 76  Naegleria gruberi
EDK42066      76 --SPLQEFSKFVTGLLIVSGVALPLSLYHC-GLIQLELFLMSVSGGFIVYGDIILFMWFFSSEV 136 Lodderomyces elongisporus NRRL ...
EAY11791      65 cnIFTADSVLFYLVCSVVSTIALNVVFWHA-GTINKKCFGFMIGGDVAVCIGFVVFMILYGKTE 127 Trichomonas vaginalis G3
XP_001320939  65 cnIFTADSVLFYLLCSIVSCIALIAVFWHC-GTIDGICFGFMMGGDAATAIGLIAFIILWGKAe 127 Trichomonas vaginalis G3
XP_001330722  60 --VITKDFLIWLLTIAVVSIIALPCVLYHLeKIGKTVSLILDIIGCVAIFAGCIVVACLdredd 121 Trichomonas vaginalis G3
EAY07081      62 --LLTVDTINWFFGVAFAASIGIPLMLWHD-KLIKDIGLGLTLGAVVIQLISYWVFNCLKKKTD 122 Trichomonas vaginalis G3
XP_001565648  70 --DAFKTIGLFIGGVLLMSGPGLALVLYHT-SVICGSALLLTLLSGVCFLGATVSLTVTTTHEE 130 Leishmania braziliensis MHOM/BR...
Q4Q9Q1        70 --DAFSTVGLFMGGVLLISGPGLAVVLYHT-SVICGLALFFTLLSGVCFITAGVSLTVADrgng 130 Leishmania major
Q57ZB6        63 --GEINGFVVFLSGALAVSAPSLSIVLYHT-GYSSLGAFLLSLGSQVTLLGAAAFLQSGerqde 123 Trypanosoma brucei
Q8MMD0        62 --NPKSEFAHFLTAGMVLSAFALPIVLAHA-LVITWTASILTIISNIINYGTIFWYAMrddepy 122 fruit fly
EFC36584      77 --TVWEHFGAFLTSFIATIGLGLLFVLAHT-GIIQWETFAFEISGGIVIVATLFISFLVFTiak 137 Naegleria gruberi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap