Conserved Protein Domain Family
DUF373

?
pfam04123: DUF373 
Domain of unknown function (DUF373)
Archaeal domain of unknown function. Predicted to be an integral membrane protein with six transmembrane regions.
Statistics
?
PSSM-Id: 397998
Aligned: 81 rows
Threshold Bit Score: 190.443
Threshold Setting Gi: 304377026
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009487790        3 TLVVSVDRTGDIPRKTGLRTPVAGWEAVQSLVTEMGIADPEDSGVNCLLEALRVTRDLRD--EDD--DAVVAAVSGDGDG 78  Halobacter...
jgi:Pyrfu_1961      5 VLVLAVDRDDDIG-RVGLNTPIVGEEAVLDAARVFGVVRPEDPDLNVLYAAVNTARSLRAq--GF--EPIVAVVAGDALD 79  Pyrolobus ...
Q9YDZ8             22 ALVIVVDLDDDVGETLG-ESVIVGYDRVLEAAVRFAIERPDDADANTMFAGLRLYRKLK----GEygDVEIAVVGGSRRL 96  Aeropyrum ...
WP_013266133       10 pLIVVIDEDDDIGATLG-RSLVMGYKDVVDAATQFAILRPEDPDSNAMFVGLNLYKEMEAd--GR--NPEIIVVGGHPKN 84  Acidilobus...
RogerUC:Ahos_1396  11 TVIIYIDIDDDLS-LAGIKSPVIGETNVKEAIDKASEIMADDSDFNSMIVAYNIYKKMKKe--GQ--DVEIVFLAGSQKG 85  Acidianus ...
jgi:Msed_1730       3 TAIIYIDIDDDLS-KAGVSTPVIGEAKAREAIEKSSRFLALDSDFNTMVTAFNIYLDMKAn--GE--DVEIVFVAGSQRG 77  Metallosph...
Q97ZG7              4 TIVIYVDIDDDIG-DLGFSTPIIGEEKCKLTLDKAAYFMPTDSDFNSMVVAFNIYTDLKRk--GE--DTEIVFISGSKKG 78  Saccharolo...
Q4J952              4 LIVIYVDIDDDLG-SIGISTPVIGQEEVAKAIRIAEEKIPTDSDLNTLLVAYNIYNKIRSe--GS--DVEIALISGSQKG 78  Sulfolobus...
WP_052846947        4 ILIIYVDIDDDLG-KIGLETPIIGEERVKKAIDIASETIPTDSDFNTMVVAYNIYKKLRKe--NN--DVEIAFISGSERS 78  Sulfurisph...
WP_013336912        8 LIVLYVDRDNDVGERLGVPTPIIGRNNVLKVATEYILRYPDDSDANAMFGAIQLYDTLIStfGSE--NVEIAVITGTSSE 85  Vulcanisae...
WP_009487790       79 -VSADRSVAEQLDDLVERYDPD-SAVVVIDSAEDERLVPIIESRLQVDAVDRVVVRQARDLESTYYLL----KQFLADEE 152 Halobacter...
jgi:Pyrfu_1961     80 pVKADLRIREQVENIVREHNIE-GIVLVADGREDEEVIPVLQGIAPILSVRRVVVEQLRGVEETYILIgrylKKALIEPR 158 Pyrolobus ...
Q9YDZ8             97 gVEAQRNLRERVASIVSEMGPDvDIYIVGDGGEEALASHILRGVGRVAGIESVIVSQHLGIESNYMLIakylRKAVTDPH 176 Aeropyrum ...
WP_013266133       85 aLLAQSLIKARVQQAISKSPGNyELYVVGDGLDELFMAQILRDVGPIAGVKQVIVEQSLGVEGSYILLaryiRKALNDPR 164 Acidilobus...
RogerUC:Ahos_1396  86 gLEAQRRISAQLDEIIKELNPQ-DSIIVYDSPEDAKALPIIQSRLKISGVQRVIVEQHRGVEETYILLgkyfKKILNEPR 164 Acidianus ...
jgi:Msed_1730      78 gLDSQMALSKQVDEVIRAIKPD-QAILVYDSPEDAKAIPVIESRLKIVGIERVIVEQHRGVEETYILLgkylKRLVTESR 156 Metallosph...
Q97ZG7             79 gTESQLEFSKKLDKVIEELSPE-YAVVVYDSPDDARAIPIIQSRLKISAVQQVIVEQYRGVEETYMLLakyiRKAVTEKR 157 Saccharolo...
Q4J952             79 sLESQLAFTEKLDMVIKAVNPT-KAIIVYDSPEDAKAIPIIESRLQVAGIERVLVEQYRSVEETYVLLgryiKKALSEPR 157 Sulfolobus...
WP_052846947       79 nIEGQIEFSRKLDEAIKTTNAE-EAIIVYDSPEDAKAIPIIQSKLKVIGIERVLVEQYRGVEETYALLgryiKKAISDPR 157 Sulfurisph...
WP_013336912       86 dVTADMKILSEVDKVLQVFDAD-GFVVVSDGPSDEVVVPLIQSRRPVVSVRRIVVKQTRGFEEFAVLAryyiGKLFSEPR 164 Vulcanisae...
WP_009487790      153 LRQTVLVPLGIVMLVFPALMLAtG----SLA-VAAASITAVIGLFLLYKGLSIDdyLAAVPG-QARDALYSGRVSIVTYV 226 Halobacter...
jgi:Pyrfu_1961    159 FARVFLGYPGVLITGFAILAMl-----gLLR-YAFTALLLIAGVLMIIRGFGLEe--------RMIEIWARNPIMTLASL 224 Pyrolobus ...
Q9YDZ8            177 YSTLVLGVPGLVISVAALLMLa-----gFFS-LALKISLLIVGLAMVVYGFKLDdtVRTSLQsFVEELREAPHIRLGGLA 250 Aeropyrum ...
WP_013266133      165 YSKYFLGLPGLLLLVFGLLTIf-----gYLL-LSLKIMAALLGFFMVVKGFNLEsqLWEYLK-TTAARVREGSVFQLAGL 237 Acidilobus...
RogerUC:Ahos_1396 165 YSRIFLGVPGAILFAAGILEVl-----gLIS-YIVPVITILIGSAMIIRGFDLDe--------MMEKWWENSTIMVIAAL 230 Acidianus ...
jgi:Msed_1730     157 YSRLFLGVPGIILFVSSILAIa-----gLTA-YVLPSILLVLGGAMLVRGFGIDd--------AIERWWENSTIMVIVAI 222 Metallosph...
Q97ZG7            158 YARVFLGVPGIILALAGILAAl-----nLSV-YIEPTILIILGVAMVIKGLKIDd--------LIESWWENSTIMVITAT 223 Saccharolo...
Q4J952            158 FSKIFLGVPGVILLIIGLLSIl-----nLTS-YATPVVLIIIGAAFIIRGLRLDe--------TVEELWKSSSIMVVVSI 223 Sulfolobus...
WP_052846947      158 FARIFLGVPGIILITIGIFSLl-----nLTV-YATPAILIIIGLALLGRGLRIDe--------YIERWWENSTIMVIAAI 223 Sulfurisph...
WP_013336912      165 YRRYALGVPGALLLIYGAFYSVwPyipaMIRtMIVASITILLGVVFILYGFNLHe--------NMLRFLRMYEATFFISA 236 Vulcanisae...
WP_009487790      227 VAAGL-ALVGVFAG------ALGVSD---LPAETALLLSAMAftyySIPWVALGALTASAGRLFDELIr-Q---GGVRTS 292 Halobacter...
jgi:Pyrfu_1961    225 IATVS-IAAAIGIAyy---tLQAMYSkpmHYVLAEILASSAP-------LIGLAGISVVAARIVSKMLgrDiavINELVS 293 Pyrolobus ...
Q9YDZ8            251 VMTLL-LLLGVSLTyi------sYVSegaTSAIVSLLTYTIP------LSMAGVMMYIIISRIIVGATegRvdlSKNIAM 317 Aeropyrum ...
WP_013266133      238 GTLAIsVVISAYGAyilsrsAAPLTDkvgYVVSYEVTTLIIG-----------MVIYVIIASVFFKVSrrNfrlYREAQ- 305 Acidilobus...
RogerUC:Ahos_1396 231 LSSIS-FAISLINGyf---tYISIKGnsvYVV-STVISSMLP-------YITFSVLILLGAKALSSALdkSiklFHDIIK 298 Acidianus ...
jgi:Msed_1730     223 LSSIS-LVLAIINGyl---vASTAGPlsiRSA-SSTLLAILP-------YLTFSIIILYSGKLLSRALskDiriWHDLLK 290 Metallosph...
Q97ZG7            224 VSIIS-LLIGVINLyi---qLQIVRGlssIQEFAFIILQILP-------YASFSAIILFGGKAISKGLnrDirvWHDIIK 292 Saccharolo...
Q4J952            224 IFIFS-VILGIVYGys---vFTTLKSynlLGV-LQVLFSIMP-------FLIFGIVVLFGGRAVTKLLdrNirvWHDIYR 291 Sulfolobus...
WP_052846947      224 ISLIS-TIVGIIEGyy---vGASIKVydlSSI-FIILTTILP-------FIVFAIIVLFGAKAINKVMnrDikvWHDIFR 291 Sulfurisph...
WP_013336912      237 LSIFF-VIIYSLSTyymlhqti-----------------plwgalnVFDLVGLVVGAILTVNAIEVYTkfRirpFGRVAA 298 Vulcanisae...
WP_009487790      293 FLNLPFGVLAVGLVV--RGFSAYFmeragrlgpievpstrfgplavrefaftpEQRLAVFVVLGVLLSV 359 Halobacterium sp. DL1
jgi:Pyrfu_1961    294 LLLVIMIVVILYQLS--ATLRSLT-----------------------------ATPTPMELALAIVSSG 331 Pyrolobus fumarii 1A
Q9YDZ8            318 LSMLGFTALAFYDLG--ASLRLVLesgqpv------------------ianviDAVASSRFIQYIIVGT 366 Aeropyrum pernix
WP_013266133      306 -------VISVLIML--AAGLYYMglsia--------------------stplPSTLNGSYVYSILIgs 345 Acidilobus saccharovo...
RogerUC:Ahos_1396 299 ISAIIISYYIITDVLknLEEGIYIiq--------------------------fQSFYALTISSMVLIFA 341 Acidianus hospitalis W1
jgi:Msed_1730     291 ILASILAYFVLTGLLrnLESGAYIiq--------------------------iQSFYLLLLSSFILIAT 333 Metallosphaera sedula...
Q97ZG7            293 IINIVIIYFILFTVVkdIIDNTYIlt--------------------------fQSLYTLILASIVIISI 335 Saccharolobus solfata...
Q4J952            292 IITTVVIYYMMVTIYksIGSSLQVlq--------------------------lQIIYSLSITTIVLIGI 334 Sulfolobus acidocalda...
WP_052846947      292 IIAVIIIYYMMVLISknLEENVIGvq--------------------------lQTMYTLSVITLVLVSL 334 Sulfurisphaera tokodaii
WP_013336912      299 DV-----LLTVFLLLvaSDLAGYMfgk------------------------vsTYTLLFNLMIYTVIGL 338 Vulcanisaeta distributa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap