2LJL


Conserved Protein Domain Family
HSP9_HSP12

?
pfam04119: HSP9_HSP12 
Click on image for an interactive view with Cn3D
Heat shock protein 9/12
These heat shock proteins (Hsp9 and Hsp12) are strongly expressed, an increase of 100 fold, upon entry into stationary phase in yeast.
Statistics
?
PSSM-Id: 397994
Aligned: 85 rows
Threshold Bit Score: 65.2904
Threshold Setting Gi: 452989321
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LJL_A         1 MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDS 59  Saccharomyces cerevisiae S288C
Q5KDF0        62 MSDAGRQSFTDKAGAALKPDSEKSYLEQAKDTIGGKADSAASTGQPQSQKSYTQEIGDt 120 Cryptococcus neoformans
EKC98440       1 MSDTGRQGLGDKLSSAAKPDSEKSYLEQAGDFVKGKADAVASAVQPQQEKSTTQKIGDA 59  Trichosporon asahii var. asahii CBS ...
Q5KHR2         1 MSDTGRQSLTDKATSSIKPDSEKSYVEQASDFVSGKLDSAASALQPQQEKSTTQKVGDA 59  Cryptococcus neoformans
CCA67377       1 MSQPGRQDFSDKVHNAVKPDSQKTFTEHIGDMAQGKADSGLSTLQPQQDKSMGQKAGDA 59  Serendipita indica DSM 11827
EIM23184       1 MSEPARRNFIDEARATMKPDSQKGYPEAASDKLKEMSDNTASKVQPEGDKSMTQSAHDt 59  Wallemia mellicola CBS 633.66
XP_003036077   1 MSQAGRQDFTDKAAAAMKPDSQKTATEQVSDYAKGTADSLASTVQPNSEKSGTQRAGDS 59  Schizophyllum commune H4-8
EME49036       1 MSDSLRQSNTDKAASALKPDSQKSTLEQVQDSAKSTADSVAGTLQPEGEKSIGQKASDt 59  Dothistroma septosporum NZE10
XP_016765154   1 MSDALRQSTTDKASSTMKPDSQKSTVESIGDKAKGASDSIAGSIQPEEQKSTTQKATDg 59  Sphaerulina musiva SO2202
EME89076       1 MSDTLRQSTADKAEATLKPDSHKSTAESVTDSAKGTADSVAASLQPKGEKSATQKATDt 59  Pseudocercospora fijiensis CIRAD86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap