Conserved Protein Domain Family
Dopey_N

?
pfam04118: Dopey_N 
Dopey, N-terminal
DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Aspergillus nidulans. DopA homologs are found in mammals. S. cerevisiae DOP1 is essential for viability and, affects cellular morphogenesis.
Statistics
?
PSSM-Id: 397993
Aligned: 118 rows
Threshold Bit Score: 187.324
Threshold Setting Gi: 122123263
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGR29985                         9 NTQNLNKALQHLLNSFEKNKDWSSVGKWLQKVEQALKenpsP------YIEDRINFCKRLAQCLNPELPEAINLAALRIY 82   Ichthyophthirius multifiliis...
EEA07550                        10 dFRKYELEILSVLQSFEKAREWADLSSCLQRLNRCIS----RefgyisEIPLKETVSKRLAQCLNPSLPSGVHIKALETY 85   Cryptosporidium muris RN66...
EDO05456                        19 DRKKFDAEVQHILLQFEKPKEWADLMNCLIKLHKSILqspiC------EIPQKEIICKRLAQCLNPQLPSGIHVRALEVY 92   Babesia bovis...
A0DP61                          24 EQQKQKIKIGAILKNYETLKEWSDLGQWLLKLQGVFQtyqgS------YIPKKKLLCKRLAQCLSPIWNKAIHENALVIY 97   Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00069330A    8 eteLLKNKLSSYLKDFQKITDWPSVNNWLLKLEQAFKdhptP------YLEDKLVLAKRLSQCLNHNLPVGTHKSTLTVY 81   Tetrahymena thermophila SB210...
XP_004036608                    14 EQETFKKLITIHLQYFEKNSEWTDYNSWLIKLGQILDenklP------QIPEKLQLSKRLAQCLHPSLPAKVHEQVLIIY 87   Ichthyophthirius multifiliis...
XP_001013068                     8 ETENLKKSLANHLAQFEKSNEWADSSNWLIKAAQILDenktP------HIPHKEIFAKRLAQCLYPSLPSKVHGLALTTY 81   Tetrahymena thermophila SB210...
Q6BFD6                           9 htsSLNTNLQYYLNKFEKNQEWADIAPLLMKIEGLLKqhpsP------YIIEKIQLSKRLAQCLNPHLSAPIHMSVLKIY 82   Paramecium tetraurelia...
XP_004034905                    11 ysdqLNKIISKLLNRFERNKTWSDLNNWLSKAIIALKenpsP------FINEKIQFCKRLAQCLNPQLPQSIHQETLKIY 84   Ichthyophthirius multifiliis...
EEQ81721                        21 KDERYFIEITKKLESFKNAQEWPDFIALLTSLDSTIQtyslP------FIPKVEFLCKRLNQCLNPLLPAGVHKKVLETY 94   Nosema ceranae BRL01...
EGR29985                        83 ENIFKNMQSVSnnnie--eyvkiFTDYIGVYSIGLFPFFSNGQLRNKFYFLNMIKKYYIPLGKDLIPCAPGLVLSILPGL 160  Ichthyophthirius multifiliis...
EEA07550                        86 GSIFEKIGSDR------------LCMDLGLYASGLFPFFVNAATQVKPIFLDLIDKYFLPVGPCLLPCLSGLIVSLLPGV 153  Cryptosporidium muris RN66...
EDO05456                        93 SSILQKVGPEG------------LAQNLALFSSGLFPFFTYSSSSVRPIFLNIIEQFYIPLGKKLLPCLIGLLICILPGL 160  Babesia bovis...
A0DP61                          98 DLILQILCSNTey---------dLVQDLPLFSLGLFPFFGFASIQCKPKFLNILEKYYYPLQKDLLPCMGGLISSIIVGM 168  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00069330A   82 KLIFNNLKLIHdiddspdsvkkhISKNLHIFSLGLFPFFSGASAQLKPDILDIIETHFCPLEMDLIPCSVGLIVSILPGV 161  Tetrahymena thermophila SB210...
XP_004036608                    88 MKIFKNIKLIKeneskq-kyinqFSQEIYLYSMGILPFYQFASLQIKPQFLKLIDDFFLDLEIQLIPFLPALIASILPGL 166  Ichthyophthirius multifiliis...
XP_001013068                    82 DKIFQNLKLLKlggdnk-kyvnqLSSDLALYAIGLFPFFQFASLQIKPQFLKLIQDYITELQVQLIPCLPGLIACVLPGL 160  Tetrahymena thermophila SB210...
Q6BFD6                          83 DQLFKNMASFSvegdps-gvvklYLEDLALYSIGLLPFFSNASSKVRPQFLDLIKQHYVPLGRELIPMLPGLVASILPGL 161  Paramecium tetraurelia...
XP_004034905                    85 EQIFENMKQISegdiq--eyqriFCQDLGLYSVGLFPFFQYSQLQLKYLFIDIIEYYYVPVGRELIPCIPGLILCLLPGF 162  Ichthyophthirius multifiliis...
EEQ81721                        95 SIIFDTISEDE------------LLENFGIYTLGLLKFGCHSRILVISTYLDLLEKYIIVLGEKIDCFTINVLYGILPAI 162  Nosema ceranae BRL01...
EGR29985                       161 DENNQELLKEIHEIYTCIM--VVCGRKYFIGSFWMAIMRSDRGKGSG-IKYLSKII-PKFKNVDNdDIKqqqnkenqqnd 236  Ichthyophthirius multifiliis...
EEA07550                       154 ENPKSECYDRVMRTFQLISdkECIGEKNFMCTLWLVLLRTAQVRFSA-LEVIMSRF------SI--N-S----------- 212  Cryptosporidium muris RN66...
EDO05456                       161 DDNKSESYEHVYKVLEQIS--DCVSEKSYMRALWVILLNASKIRMST-LTVIANKLaPGLP------------------- 218  Babesia bovis...
A0DP61                         169 EDTNEEMMKKVMSSLDQAA--ESVGIKQFFGLLWVSIIRSGRCRLGA-YKYLMKRW------SK--Q-Qq---------- 226  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00069330A  162 VENNEEIQRKTFQIFEQLQ--VKIGKKYLYGALWLSILRLPRTRVAA-YTCLSKLF-KKNDQQNLaSIDiephiikklqq 237  Tetrahymena thermophila SB210...
XP_004036608                   167 QDNDEQIKKQTQNILDKIQ--SIVGYKYFFSALWLTILRVPRIRIVG-YKLLNKKT-SNIQNMEDsGLFrdndqvlqnti 242  Ichthyophthirius multifiliis...
XP_001013068                   161 EDNDESVQRQTIKLLDTVQ--EGVGQKYFFAALWMTILRIPRIRIGG-FKYLNKKT-KPFKQIEAeQIDyefqnfeqkse 236  Tetrahymena thermophila SB210...
Q6BFD6                         162 DDQQEANQKNCMSVLDELS--QSAGRKFLIGSVWMSMLRSSKCRSSS-IKYLSQKI-PKMQQEQEdEQSdymsdeyeeee 237  Paramecium tetraurelia...
XP_004034905                   163 EENNKEIKLKIKNCLLLLM--KACGRKYFYGGFWMAIKRVQKETFSK-------------QEIEEqQEQqeqeinnkprd 227  Ichthyophthirius multifiliis...
EEQ81721                       163 ESEASECYDKGIELIKKFR--VEIDEKKFYNSLWMIFLQNKDLRQSIiLFLMNEKI------------------------ 216  Nosema ceranae BRL01...
EGR29985                       237 kqqynqenqqkendneeiqnyqqnnkqegfeqnqsieneqelvqtqqqtnevqkkipnkrttlrdnidrikqniyhnkdl 316  Ichthyophthirius multifiliis...
EEA07550                           --------------------------------------------------------------------------------      Cryptosporidium muris RN66...
EDO05456                           --------------------------------------------------------------------------------      Babesia bovis...
A0DP61                             --------------------------------------------------------------------------------      Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00069330A  238 snqftqeevffsqteettenyspfi---------------------kvyeqqrnldlgvrniedqhleedhifneqevml 296  Tetrahymena thermophila SB210...
XP_004036608                   243 scsslysnqidfkqknstqninnesn-------------------lqddqnkkndeylssssqdvqiedpivkiqeells 303  Ichthyophthirius multifiliis...
XP_001013068                   237 dslygdskqsnsnnslrikknseysikde--------------ninftgqqsfdqevegeirisydhfqdpiaqlqvqlm 302  Tetrahymena thermophila SB210...
Q6BFD6                         238 qqksqqiiaqeqqqnqlkapqnnqdled---------------ikddsiiqamdnkaqneirkrtivveqsmelkrkqal 302  Paramecium tetraurelia...
XP_004034905                   228 sdnlevyifqsklhnknyqqniihndlii--------------yeseikkkqqkiieneeeevqinsfqeniyrnnrkel 293  Ichthyophthirius multifiliis...
EEQ81721                           --------------------------------------------------------------------------------      Nosema ceranae BRL01...
EGR29985                       317 lyLekdIDENNLENNYPNKSTVVVNTILSCIEYENVIVKRNIIDFLQSHLPAQ------NDD--ILSENEKIQILEGLLY 388  Ichthyophthirius multifiliis...
EEA07550                       213 --SdmeIEVEKLESLI-TYPFLVVKALESCFEDENILVKRHLLDFLISNIPLGksshqiSDLfsV---ECKVLLMRRGLK 286  Cryptosporidium muris RN66...
EDO05456                       219 --M---LPPERVEILVPHRHVLVMKSLEATTEDESLLVLREMINMLIKHFPMD------SDIlsD---EDKSVLCRQCLK 284  Babesia bovis...
A0DP61                         227 --VdieNCILQEDEKMPNKKALVINALLASLEDESILVKRAALDFMCLYCKIS------ENVfqE---QENLILIEQCLL 295  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00069330A  297 qnInevKNQDDFNARFPNKSALILNALVQTLEDENNQTKKFGLDFLLNYFPIL------GD---SLSESDKLVLTQCVLY 367  Tetrahymena thermophila SB210...
XP_004036608                   304 nvVktsKQITGNDVLFPNASSLIINALLNTLEDENNLIRRQGLDYIINTFPIQ------NDT--IFSKNDKKLLIQSCLQ 375  Ichthyophthirius multifiliis...
XP_001013068                   303 kqInaiKDLKSEENFYPNKSNLIINALLSVLQDENILTRKFGLDYITSHFPIE------ED---ILSDTDKQLLVQQCLY 373  Tetrahymena thermophila SB210...
Q6BFD6                         303 miIedgIDEETPENNFPP---LYVSALISSLEDENQLIKRQALDMMYTHLKSN------------VIQESKEILVEASLK 367  Paramecium tetraurelia...
XP_004034905                   294 lyIekgIDDNTLYNKYPNKGCLVLNVILSCLEDKDVFVKRNILDLLIHYIPLN------NNNvqILSFEEKTILCEGVLR 367  Ichthyophthirius multifiliis...
EEQ81721                       217 -----------NYDTMISDKLLVIKALKEGLKSDDLLILRGTLNLILHMFPLK------EKIfsE---SMNSDLLEGMFL 276  Nosema ceranae BRL01...
EGR29985                       389 LFIKKDISVIRRANIWLFGKPD 410  Ichthyophthirius multifiliis
EEA07550                       287 LLLLGEWSLTRRILQWISNQRQ 308  Cryptosporidium muris RN66
EDO05456                       285 LLTKRNWSLNRRLYHWIFNATN 306  Babesia bovis
A0DP61                         296 LFIKLDHAVVRRINNWFFGEDE 317  Paramecium tetraurelia
WGS:AAGF:cds.TTHERM_00069330A  368 LFLKNEYSIVWKCHQWLFGEAD 389  Tetrahymena thermophila SB210
XP_004036608                   376 LLVKNEYAIVRRINTWLFGPPD 397  Ichthyophthirius multifiliis
XP_001013068                   374 QFHLNEFTVMRKINIWLFGPPD 395  Tetrahymena thermophila SB210
Q6BFD6                         368 LLIRKDLSVTRRVNQWLFGKPD 389  Paramecium tetraurelia
XP_004034905                   368 LFAKRDISLIHKISFWMFGKPD 389  Ichthyophthirius multifiliis
EEQ81721                       277 IFGKREQSLNKKVFSWINIAED 298  Nosema ceranae BRL01
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap