Conserved Protein Domain Family
APG9

?
pfam04109: APG9 
Autophagy protein Apg9
In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg9 plays a direct role in the formation of the cytoplasm to vacuole targeting and autophagic vesicles, possibly serving as a marker for a specialized compartment essential for these vesicle-mediated alternative targeting pathways.
Statistics
?
PSSM-Id: 397984
Aligned: 107 rows
Threshold Bit Score: 294.396
Threshold Setting Gi: 122078152
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002288788 127 EGWALVSDLDLFFSSLYNYYYMRGLGSIIGKGVVELISLFFTLWLSLVLFAYIDWSGLsscndee-------tckesfVE 199  Thalassiosira ...
EFC49244      87 REHLGVTNLDAFFQQVYVYFYEKGFWCMLVDRCLRLCTVFFMMIFSTFLFVFLNWYDMwhcqdvac-----ktvpvfrKN 161  Naegleria gruberi
Q387F1        14 QNSGRIGDVHVFMKNLYRFWVYKGLWFSCLASLVDFLNSVVVFCLVVFLTTVFDWPVAa------------------aCD 75   Trypanosoma br...
OWR41225      56 SRWNHIKDLDSFFTRMYSYYVRGGFYPMIMSDFFYLLQFIFIVWFSTFLVHCVDYPRLfrndp-----------eanrSE 124  Danaus plexipp...
XP_016661306  28 SRWSHIEDLDTFFTRIYLYHQRHGFICLILQSILSLLQVIFLLVLSLFLFYCIDYPVLfrdkpad------ssrvmngTD 101  pea aphid
XP_009028971  55 SRWNHLSDLDEFFTRIYAYVQRHGFLAMALQDIFQIIILWYVVIFPTFICVGVNYDVLfqdh-------------fniTY 121  Helobdella rob...
XP_001635029   6 GRWNHIENLDEFFIRVYEYHRHDGFACILLTQCFELVQFAFVVLFTSFLLLCVDYDKLfk-------------------- 65   starlet sea an...
XP_003384679  40 SKWNHIENLDEFFDWVYQYLINHGLFAIVLNDILELGQFAFLCIFSAFLITCINFKNLfaddvy---------tnetgVK 110  Amphimedon que...
Q6EBV9       183 GSWHHIQNLDSFFTKIYSYHQRNGFACILLEDVFQLGQFIFIVTFTTFLLRCVDYNVLfnnqpkn------htrrgplHS 256  house mouse
XP_007504680 174 GSWHHIQNLDSFFTKLYNYHQRNGFACMFLEDAFQLGQFVFVVTFTTFLLRCVDYDILfanrpvnhtrpgshqnpgilQS 253  gray short-tai...
XP_002288788 200 --GYLIENPF--------MEGRHSfLRNAWIVVY--CMLFSSYGVFCLIQF----------------------------G 239  Thalassiosira ...
EFC49244     162 vwTMNAFHIV----------------------VLlfEFVVCFYWMYLLVKY----------------------------L 191  Naegleria gruberi
Q387F1        76 --EVSCGTVTlthhmrlpTERGAShVLLCLIL----LVSSAASATYEFLKFletcslqmetermvrvivdtgytspfhrL 149  Trypanosoma br...
OWR41225     125 --KLTLNDVIf------sTSVCVS-HISWTWWCL--ITLCCIIWIMKFFIS----------------------------M 165  Danaus plexipp...
XP_016661306 102 --KVRLSDVFl------pASKCTS-KFTFLTYLY--MIPLLMFAFFRLMKV----------------------------F 142  pea aphid
XP_009028971 122 --KVIINDAIr------pWKEVKE-RFNPFLILF--LITSSFYLVFKTFKG----------------------------L 162  Helobdella rob...
XP_001635029  66 npDPTFSEVVh------fHK--IE-HMEPAIVVC--LVIALLFWFIRLARV----------------------------F 106  starlet sea an...
XP_003384679 111 --DVAFGDVIeid---------rleHINPLLVLI--LFFAFIFWFHRLCKT----------------------------I 149  Amphimedon que...
Q6EBV9       257 --KVTLSDAIl------pSAQCAE-KIHDSPLLVflLVLAAGFWLFQLLRS----------------------------V 299  house mouse
XP_007504680 254 --KVTLSDAIl------pAAQCAQ-RVRSSSILIflLFLASGFWLFRLLRS----------------------------L 296  gray short-tai...
XP_002288788 240 HSVMASLESKMFLEEVLGVSDRDleVGRVEWGEIVERMS-DAQRdgrcRVAILpmDkqkHVDNnnnnnnnstiiedegpt 318  Thalassiosira ...
EFC49244     192 RDLLGMLSIKHFFNTELNITEKD--IQTIQWVEVVEKII-EFQN----KKKIN--Ii-kNVDE----------------- 244  Naegleria gruberi
Q387F1       150 AHIWRRMRVQSDGHEELPDHGLPf-IGNMAWGDFLDEVCaRIQR----DRSFGviEh-kEFDS----------------- 206  Trypanosoma br...
OWR41225     166 YHLYYAYDTKLFYNNALKIKESE--LTWVTWSTIQDRVR-EAQP----EHQMC--VhkqEINE----------------- 219  Danaus plexipp...
XP_016661306 143 NVAYHFADIKAFYNVALHIPDKE--LQNYTWREIIHKII-EAQK----EHNMC--VhklDLTE----------------- 196  pea aphid
XP_009028971 163 YNISKYWEIRRFFTYALEIQPSE--LANKKWHEVQTLLM-LVQQ----KLHMC--VhknELTE----------------- 216  Helobdella rob...
XP_001635029 107 IYFFKLLEIRMFYKNALKIPESE--IVNLQWQDVQKRLI-EIQK----IHQMC--VhkeELTE----------------- 160  starlet sea an...
XP_003384679 150 WRFFKFLGIRRFYIEALDIPPSD--LRNYNWRDVLERLK-SAQN----THKMN--IrkqELTE----------------- 203  Amphimedon que...
Q6EBV9       300 CNLFSYWDIQVFYREALHIPPEE--LSSVPWAEVQSRLL-ELQR----SGGLC--VqprPLTE----------------- 353  house mouse
XP_007504680 297 CNLLNYWDIRTFYKEALHIPPED--LSKVPWGEVQSRLL-ALQR----GGGLC--VlprPLTE----------------- 350  gray short-tai...
XP_002288788 319 ghLVVSQRIMRRENFMIAFFNKGLLDLTL--PQFPPWawplsawtrrpreekqVFFSKSIEASIYFCVLNYMYNN----- 391  Thalassiosira ...
EFC49244     245 --FDILNRIMRKENYLISFINKDVMNLTL--PFSQKT-----------------YLSEIIVYNLRI-VVDNMFDS----- 297  Naegleria gruberi
Q387F1       207 --LRAVQALMVYENYFITFHQHGILERGA---------------------------LKYADENVIRMLIRSLFD------ 251  Trypanosoma br...
OWR41225     220 --LDIYHRILRFNNYMVAMVNKNLLPLQIhvPFIGDF----------------HYLSRGLKWNLEFLLFYGpw------e 275  Danaus plexipp...
XP_016661306 197 --LDIYQRILRKKNFLIALVNKSVLPTHFniPFLGDV----------------IYFSHGMKYNLNLLLFLG---Pwspfe 255  pea aphid
XP_009028971 217 --LDIYHRILRFKNYMVALVNKSVLPMKFnlPFWGEI----------------VYFTSGLKYNYEMILFWG---Pgapfa 275  Helobdella rob...
XP_001635029 161 --LDIHHRILRWKNYFVAMQNKGVIPCTYrfPFLGQR----------------TFLTEGMKYNLKMILFWG---Pgspfq 219  starlet sea an...
XP_003384679 204 --IDVYHRILRFKNYMVAMINKDVLSYKIwiPFYGEK----------------VFFTMGLKYNYELLLFWG---Pgapfk 262  Amphimedon que...
Q6EBV9       354 --LDVHHRILRYTNYQVALANKGLLPARCplPWGSSA----------------AFLSRGLALNVDLLLFRG---Pfslfr 412  house mouse
XP_007504680 351 --LDVHHRILRYPNYLVALANKGLLPARFplPWGGSA----------------TFLSQGLALNLDLLLFRG---Pislfr 409  gray short-tai...
XP_002288788 392 -SKKIRPAFYGD------PSSLRRRFVLCGVAHAVFMPFLLFFVTLHFFMLNIYDWQSTKEYLGPREWSSVARWTFREFN 464  Thalassiosira ...
EFC49244     298 -EFKINEAFVKN------PNALRAFFVKLGLINLLLAPFLLIYIILYTSFKYLAELKNDPKKALGRRWSLYSTFKFREYH 370  Naegleria gruberi
Q387F1       252 -------EFSTLvrgkdhVTLLRWKVVKYLVVYALFYPFVVAHFLLRVLVKNAAMVRTDWGGYMTKDWNKRALWTFSLYN 324  Trypanosoma br...
OWR41225     276 sRWQLRSAYKDHtkrmllARQLERQIILLALVNLILAPLIQAWQILYFFFNYAELIKRSPGSLGLRTWSLYARVTLRHFN 355  Danaus plexipp...
XP_016661306 256 nNWHLKPEYKQPekrlelAQSMRKTISWVALINILLSPVIFTWQLIYKLCDNAQMVKNEPSILSIRMWSLYSKIYLRHFN 335  pea aphid
XP_009028971 276 nSWHLRKEYKSYnkrkelATILSRRIFIAGIINLLLAPVIFVWTLLYLVISHFALFRTDPGQVSLRSWSLYGRQYLRHFN 355  Helobdella rob...
XP_001635029 220 dNWKLRDDFKNl------SKRLSRRIFWIGVANFLLCPFILLWVVLYSFFSYAELVKRAPDALGARRWSPYGRLFFRHFN 293  starlet sea an...
XP_003384679 263 nNYHLHEEYKTAakkyelIQKLRFRITVLALVNLVFSPFIFLYQILYSFFTYAELLKRQPGVFGRRRWSLFGKIFLRHFN 342  Amphimedon que...
Q6EBV9       413 gGWELPEAYKRSdlrgvlANRWRRTVLLLAAVNLALSPLVLAWQVLHAFYSHVELLRREPGAFGARRWSRLARLQLRHFN 492  house mouse
XP_007504680 410 gGWALPSTYKRScqrrtlAIRLRWTLLFLALVNLALCPLVLAWQGLHAFFSHAELLRREPGALGMRRWSRLARLQLRHFN 489  gray short-tai...
XP_002288788 465 ELPHLFERRMEPSYKSASAYLDLFgkPSPLSIAIGRLLVFVSGSLGTLLLAFAAINDAILLHVKIGQWNLLWYAGIMGAC 544  Thalassiosira ...
EFC49244     371 ELAHEYERRLKEGYGPSIDYLNQF--PNVLLSIVANRAMFFISAIAGVIIVLSYLNNSLTLYLTVFNQNLLTWLTTLLLG 448  Naegleria gruberi
Q387F1       325 EVPHVLSARIASGRQIVMEMICRLkpHSS----GKRFVCRVASGIILVLLSLSLVNTSLLVSGNLCGIPLLWWLTGSIAA 400  Trypanosoma br...
OWR41225     356 ELEHELRDRLNRAHKPATKYLASF--SSPITTVLAKNAVFLSASVLGVLVVLSVYDEDVL-----TVEHVLTIITILGCV 428  Danaus plexipp...
XP_016661306 336 ELDHELSARLSRAYVPGAKYLQSF--AAPVSVIIAKNTMFFTSAIMVSILAMTVYDDSIL-----SIEHMITILSGLSLL 408  pea aphid
XP_009028971 356 ELDHDFNARLNRGYRAAVKYMGLF--WSPVMAAIAQFIVVISSGFLIFFVICAVTDEDTL-----AVQGVIKIMTLLGLV 428  Helobdella rob...
XP_001635029 294 ELDHEFQARLNKAYEPAQKYLNIF--SSPFLAIIAKNVAFLAGAVFAVLTTFTLVDRDVL-----MAEHMLAVIAGLGIL 366  starlet sea an...
XP_003384679 343 ELDHELIVRLNRAYLPAGKYMDLF--VLPVATILARNVAFVAGSLLAVLFTLTVIQEDLL-----TAHNILTAITGLGVI 415  Amphimedon que...
Q6EBV9       493 ELPHELRARLGRAYRPAAAFLRAAepPAPLRALLARQLVFFSGALFAALLVLTIYDEDVL-----AVEHVLTTMTALGVT 567  house mouse
XP_007504680 490 ELPHELRARLARAYRPAAHYLRAAapPAPLPALLARHAGFFAGALLAALLVLTVYDEDVL-----AVEHVLTAMTGLGVA 564  gray short-tai...
XP_002288788 545 FSVGKSLLP-KTTspyygharrnLV-LDM------NSELEKVATHTHYFPDAW--RGKGCDDRTKKSFSSMFQFKAQHFA 614  Thalassiosira ...
EFC49244     449 WAFAKGFVI-DEH----------AV-FNP------KQKLDDVCEILHHHDLKW--KGKGHHHDVRDDFVAHFIPSYSYFL 508  Naegleria gruberi
Q387F1       401 FSVCNETPPvERE-------------YNY------LPDLERLVKQLHYSQEEWnhSGESFYSAVTWDF---LESRFSVII 458  Trypanosoma br...
OWR41225     429 LAGARALIG-EEE----------RL-GGScgpargEELLVQVLGHVHYLPAAW--RGRAHTRHVAAHLQHMFQFRAVYIL 494  Danaus plexipp...
XP_016661306 409 FLICRSLVD-DDK----------EI-VCQ------ESLMTAILTEVHYLPDSW--VGKAHTQQVSNQFSQIFPFKANYLF 468  pea aphid
XP_009028971 429 VSVVRHLIP-DEN----------MV-RNP------ETLMTLIQSQTHYMNDSW--KGQAHTRKVMDEFSQLFQYKLVYLI 488  Helobdella rob...
XP_001635029 367 IRGCYVFIP-NEN----------LV-WNP------EQLMRQILSYTHYIPETW--KGKAHTTEVRDQFAQIFQYKLVNVL 426  starlet sea an...
XP_003384679 416 VTLCRIFIP-NEH----------QT-RDP------KELMTEILEEIHYMPDLW--KEKPHTVQVSSQFSQVFQLTIAYLI 475  Amphimedon que...
Q6EBV9       568 ATVARSFIP-EEQ----------CQgRSS------QLLLQAALAHMHYLPEEP--GATGARASSYWQMAQLLQYRAVSLL 628  house mouse
XP_007504680 565 LTVARCFIP-EEE----------LLgRSP------KPLLQAALAHMHYLPEEP---GSVREANTHHQMSQLLQYKAISLL 624  gray short-tai...
XP_002288788 615 MEVVSIIVAPLVLCFSLP-RCADDICRFVRDSKVEVPSAGDVIGYCTFD 662  Thalassiosira pseudonana CCMP1335
EFC49244     509 NEIVSVFVTPIILIISLP-RSAERISSFVDQITVDYHGLGHICGHAAFK 556  Naegleria gruberi
Q387F1       459 SDIARTLFMPCILLGLLFdGSLPALMECVQSESVRVDGLGSVAREAAFD 507  Trypanosoma brucei
OWR41225     495 FELLSPLLCPLVL-FQLR-TRAVDIVDFYRNFTVSVLGIGDVCSFAQLD 541  Danaus plexippus plexippus
XP_016661306 469 NELISPIVTPFILFFWLR-PRSLEIVDFYRNYTAEVAGVGDVCAFSMMN 516  pea aphid
XP_009028971 489 NEMVSAIVCPFILIFSLR-PNSLQIVDFLRNFTVTLEGIGDVCSFAQMD 536  Helobdella robusta
XP_001635029 427 EELVSPVVTPFLLCFSLR-YKALDIVDFYRNFTVDVVGVGDVCSFAQLD 474  starlet sea anemone
XP_003384679 476 DELLSPLVTPFILYFSLR-NKSQDIIDFLRNFTIDVSGVGDVCSFAEMN 523  Amphimedon queenslandica
Q6EBV9       629 EELLSPLLTPLFLLFWFR-PRALEIIDFFHHFTVDVAGVGDICSFALMD 676  house mouse
XP_007504680 625 EELLSPVLTPLALLLWFR-PRALEIIDFFRHFTVDVSGVGDVCSFALMD 672  gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap