5JHF


Conserved Protein Domain Family
APG17

?
pfam04108: APG17 
Click on image for an interactive view with Cn3D
Autophagy protein Apg17
Apg17 is required for activating Apg1 protein kinases.
Statistics
?
PSSM-Id: 397983
Aligned: 80 rows
Threshold Bit Score: 229.031
Threshold Setting Gi: 575518343
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5JHF_F         8 KLLENSRKFLTgAKLICQESNDHLTTTKLRIREWQKFQSKLHFVLDCIQQQTKFLSEilLREGIGRNLieeEWSQTVLVR 87  Lachancea therm...
Q757A7         9 gFYFNAQRRLSrAQALCQNSQDTLHNMQLLLVRWQRTVSKLQFTIHCICNQTVFLAEciLKKTVGQQLietEWKRMLLDE 88  Eremothecium go...
XP_003647694   9 vFWENAQKYLSkAQVLCQKSQATLTSSQSRVTELQRTVSKIQFTLGCIHNQATYLANdiLTKTIGNQLiqrEWKKVVLDD 88  Eremothecium cy...
Q6FPD4         4 SLAERARSTLLkAQVLCREVESRIAEVKDRLSQWEKNRHTLRFLVSCLEHQLGFLEQcaLRQGIGRALietEWSQVVLVD 83  [Candida] glabr...
XP_002495534   8 iFVSNARNFLVeAQVLCEEASMRIVGAKGELSKWQQDVSKLRFMISCLKSQGDFLYKnvLKVGIGENLiktEWSQVMLVD 87  Zygosaccharomyc...
CCE91702       8 lFVSNARKTLVeAQVLCQEASMRISGAKGSLSRWQQEVSKIKFMIISLKNQGEFLYKciLKVGIGENLikkEWSQGLLVD 87  Torulaspora del...
XP_003678497   5 KLVDNARKILVeAQLLCQESNSQIYTFRNDLSLWQRQLMKLKFVIGCLKQQGSFLLHcvLEKGISEKLirdEWGNNVLKE 84  Naumovozyma cas...
XP_003672390  10 iLVEHARKTLVeAQILCQETNLQIFEYENELDRWQQSCGKLKFIIDCLKQQVGFLYHciLEKSIEKNLihnEWEKFILVD 89  Naumovozyma dai...
Q06410         8 KFVNNARKTLTdAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYt-iLKEGIGTKLiqkQWNQAVLVV 86  Saccharomyces c...
A7TM40         5 RFVNASRKTLVeAQVLCQDANSRISNARSSFSHWERSISKIRFLLNCLKNQGSFIKNciLKVGIEENLiekEWTQSILVD 84  Vanderwaltozyma...
5JHF_F        88 LVNDMKFWQNEITKMMNKLDNITNEIDqq------------------hnSKLGDFISRDSSHILDSKLNEIptirkqven 149 Lachancea therm...
Q757A7        89 LQGEMQRSQEEITGKIDALRRTKNELDgs-------------------gATLADFISMENIFLLGDKLKDVpvvqeqveh 149 Eremothecium go...
XP_003647694  89 MLKEMQHCQEKMVLKVEALSNMENTLShd-------------------gRNLADFISMDNMHILNEKLKDLpvvksqvsn 149 Eremothecium cy...
Q6FPD4        84 LVNEMKLWYDKIQLRLERLDQVENILVad-------------------nKHLSHYISQEQALVLKKRLDEVpiirpqien 144 [Candida] glabr...
XP_002495534  88 LIKTMKYWQDQISARVAQLNNINNVLVsgndt-------------nddqLNLGDFIPKENTHILDERLKEIpiikqqien 154 Zygosaccharomyc...
CCE91702      88 LIDSMKSWQEQLTTRIAQLDGVDNKLVssdd--------------ngehVKLGDFIPKENAHILNERLKEIpiirrqidn 153 Torulaspora del...
XP_003678497  85 LVSEMRIWQDKITDQVSRLDQIDNVLVhtet--------------gtlnPKLSDYISRDNVNILDERLMEMpviqkqies 150 Naumovozyma cas...
XP_003672390  90 LVEEMTLWQNRISKQIEKLDDLDNVLLfkgneknqeeeeeeeepgsesvQKLGDYVSRENIFILKERLQEIptiqrqien 169 Naumovozyma dai...
Q06410        87 LVDEMKYWQYEITSKVQRLDGIVNELSisekd-------------dtdpSKLGDYISRDNVNLLNDKLKEVpvierqien 153 Saccharomyces c...
A7TM40        85 LAKELKYWNSKINEQVRVLDSIENILDedtk---------------sesKNLGYFVSRDNLDILEKRLKEIpnvkyhidn 149 Vanderwaltozyma...
5JHF_F       150 iTRQYQTMLAKVQSQLVESRMKGLRDEFSSKFGDQCrENLKLNEEFTNEADQLEQELADFLKSFTDHFDKCSALss---- 225 Lachancea therm...
Q757A7       150 iKVQYESLVDKVVEQLQNNRVRKLEADFAAAFRSGKnDFNAFSMKYLQKIRQLETDLADILKSLTDHYDKCSLLka---- 225 Eremothecium go...
XP_003647694 150 iIAQYESLVEKVTNQLLKARVRKLEEEFNDFFVSDR-GKYVLLDNYLHDIHHLEEDLVDILKSLTAHFDKCTLLkt---- 224 Eremothecium cy...
Q6FPD4       145 iQTQYDTMCKRVRQKLINKRLTEIKTIFDSQFGDELtETAELTEVKPRDLDSIELELVDYINSLTDHFDKCQALek---- 220 [Candida] glabr...
XP_002495534 155 iTSQYHNMTKKVGEQLIFTRIKTVEATFNKNLGSESlENKTLSIELPEEMDNLEHELVEYINSLTDHFDKCKLLqs---- 230 Zygosaccharomyc...
CCE91702     154 iKSQYSNMMKKVQEQVIQTKLKNLETLFEEKYGPSStGSIELGESYLLEMTNLEHELVEYLNSLTDHFDKCRLLqs---- 229 Torulaspora del...
XP_003678497 151 iKSQYASMLKKVKENVNETTLREIELTLEDKFGNNCpDTITLSETCPDELDKLEKDLAEFISSITEHYDKTKLLetye-- 228 Naumovozyma cas...
XP_003672390 170 iRSQYTKMYVKVKDNLIDSKLKDLEKEYQNKLNIQDkQVFELTNISPQVLKSFEIELVDFLSSLTDHFDKCQLLesyvtg 249 Naumovozyma dai...
Q06410       154 iKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNlMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLqd---- 229 Saccharomyces c...
A7TM40       150 iRGQYNTMFKKVSNYLINKRLKSVQEYFLTNFENDSdDIKKLTTTLPSKLVSLEHDLADYLSSITNHYDQSKLLqt---- 225 Vanderwaltozyma...
5JHF_F       226 --------------------------------rsVSPED----------AQNLFEIVERDDKDLAAINSLLQDAAIDVas 263 Lachancea therm...
Q757A7       226 --------------------------------gdLPAAE----------QAELFEVVKNDDQELDSIMGVLEVIVRDIks 263 Eremothecium go...
XP_003647694 225 --------------------------------kkLPTKE----------QEELFKIVKNDNAELESIMGMLIDIIVDIne 262 Eremothecium cy...
Q6FPD4       221 --------------------------------glFNDSNe---------YDELLKIVSADDSQLDDIMKHLLNTIDSTnh 259 [Candida] glabr...
XP_002495534 231 --------------------------------kkLEGPS----------YQELLKVVTKDNGELGSILETLKDTIRDVdq 268 Zygosaccharomyc...
CCE91702     230 --------------------------------geLQGQN----------KQELLEIVTRDNSELSSVLVTLRDTIEDVdk 267 Torulaspora del...
XP_003678497 229 -------------------------------kknLEM------------YESLYEVVTEDNNELPCIMTSLKEKISLVdr 265 Naumovozyma cas...
XP_003672390 250 qnkldtnpdgkpdetrdrvgddltvdeleekkkdISAPNdlsksetdadYEMLLEIVTKDNNDLEFVLKTLNETIELGts 329 Naumovozyma dai...
Q06410       230 --------------------------------kkIDNDE----------REELFKVVQGDDKELYNIFKTLHEVIDDVdk 267 Saccharomyces c...
A7TM40       226 --------------------------------lkPADPD----------YTDLLEVVKNDNSELDGIVTLLRETVDEVde 263 Vanderwaltozyma...
5JHF_F       264 fvRKVNMLLDERDADKAKMQATLSKLLTELRKHEEYISvfeGISALIQKFKASCLEDIRQTRNLLDFYANFERSYHNLLK 343 Lachancea therm...
Q757A7       264 laKNVSIRLRQKERDKQQLKNAMGKAHSELLKYEEHLTvfqGIDDLIRNFKASCLHNVSKVRELCEFYDNFLNSYQVLLR 343 Eremothecium go...
XP_003647694 263 laENITLKIRQKDKEKQLIKNSMVKILGDFTKYEEYLSvfqGVNESIANFKNSCIQDIKKVQELCDFYDNFLNSYQQLLR 342 Eremothecium cy...
Q6FPD4       260 qiDKVYEILDIKTKQKTILHGKINELIANCTKYSEYLAifkGIATSIEKFKEGCMQDIQLTKELYKFYDEFENSYNKLLQ 339 [Candida] glabr...
XP_002495534 269 vlENFKNLLERKTIDKVNLHSQINKLINEFHKHQEYLMifkDISELISTFKESCLQEVKLTKELCEFYQNFKTSYYNLLD 348 Zygosaccharomyc...
CCE91702     268 llLKFRITLEKNMADGNQLQTDIQKNVSEFQKYQEYLVifrDISELISTFRETCLQEIQVTQELCDFYENFEASYYKLTE 347 Torulaspora del...
XP_003678497 266 tlLKYQTVWDKKKLEKKLLQQNISKMNEEFKKYYEYLQifkDISNLISTFKESCIADIQMIKDLFQFYKNFEKSYEDLLA 345 Naumovozyma cas...
XP_003672390 330 rlSSYKELLSEKIGMKDELHNQVKKLIEEVLKYQEYLMifkDISDLLTTFKEGCMDDIRVVEDLCEFYTNFEKSYQNLLK 409 Naumovozyma dai...
Q06410       268 tiLNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLifkDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVL 347 Saccharomyces c...
A7TM40       264 tlKTFLGIFNEIELKQKECNKLLFGVIEEFKINHEYLLifnDISSLIDNFKETCIEDINNTRSLCIFYQKFEIGYQNLLF 343 Vanderwaltozyma...
5JHF_F       344 EVKRRKETAAKLSQILKSCETQLEQINTADLRERQMFLLENGNYLPETIWPDEIGSL 400 Lachancea thermotolerans CBS 6340
Q757A7       344 EVERRRRVAKQMEDILQACEGQLMALSDTDLKQRQQFLMRHGDYLPENIWPGNIDDL 400 Eremothecium gossypii ATCC 10895
XP_003647694 343 EVDRRRKLAERMKSILQSCENQLAELNNSDLKKRQLFLLEHGDYLPENIWPNNIDDL 399 Eremothecium cymbalariae DBVPG#7215
Q6FPD4       340 EVQRRRALSQKMLGIIKNCENELKTLHDEDQKLRTHFLSENGAFLPETIWPGEIDDL 396 [Candida] glabrata CBS 138
XP_002495534 349 EVERRRSVAQEMTIVLQESQQKLHALHTQDQKAREGFLSENANYLPETIWPGKIDDL 405 Zygosaccharomyces rouxii
CCE91702     348 EADRRRSVAKQMEDLISDCENKLQKLSNDDHKARERFLSLNGDYLPETIWPGKIDDF 404 Torulaspora delbrueckii
XP_003678497 346 EVERRKLTCKKMKAIILQCEEKLQALSEEDLGARELFLNDNGNYLPENIWPNKIDDF 402 Naumovozyma castellii CBS 4309
XP_003672390 410 EVERRKQVRNKMEIILNECDNKLQKLNSRDQKMREIFLNENGNFLPENIWPNKIDDF 466 Naumovozyma dairenensis CBS 421
Q06410       348 EAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDF 404 Saccharomyces cerevisiae S288C
A7TM40       344 EIERRKTVAQKMTDIIKNCELELSKINEEDQKNRSEFLKLNGDYLPENIWPGKIDDF 400 Vanderwaltozyma polyspora DSM 70294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap