6ATB,1VLP,4HL7


Conserved Protein Domain Family
NAPRTase

?
pfam04095: NAPRTase 
Click on image for an interactive view with Cn3D
Nicotinate phosphoribosyltransferase (NAPRTase) family
Nicotinate phosphoribosyltransferase (EC:2.4.2.11) is the rate limiting enzyme that catalyzes the first reaction in the NAD salvage synthesis. This family also includes Pre-B cell enhancing factor that is a cytokine. This family is related to Quinolinate phosphoribosyltransferase pfam01729.
Statistics
?
PSSM-Id: 397974
Aligned: 14 rows
Threshold Bit Score: 224.182
Threshold Setting Gi: 81536759
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ATB_D 188 YKLHDFGYRGVSSQETAGIGAS----AHLVNFKGTDTVAGlalikkyygtkdpVPGYSVPAAEHSTITAWGKDHEKDAfe 263 human
Q9CM44 173 FKLHDFGARGASSLETVALGGL----AHLVNFMGTDSVSAlvaakr-wynttsMPAFSIPAAEHSTMTSWGKDREADAyr 247 Pasteurella multocida
Q9APM3 191 FQSHDFSMRGMSSLESAETSGA----GHLTSFLGTDTIPAlsfvea-yygsssLIGTSIPASEHSVMSSHGVD-ELSTfr 264 [Haemophilus] ducreyi
Q55929 170 FKLHDFGARGVSSGESSGIGGL----AHLVNFQGSDTVKAlvygqq--yyncpMAAYSIPAAEHSTITAWGREGEVLAye 243 Synechocystis sp. PCC...
Q9RXL6 175 FKLHDFGSRGVSSRESAGIGGL----AHLVNFQGSDTLEAlrvgrn--yygaeLAGFSIPAAEHSTITSWGKEHEVDAyr 248 Deinococcus radiodurans
Q9PED1 165 CSIADYGTRRRYSRQWHAELLPllaqGLGSNFVGTSNVYF-------------AKQYGYTPLGTMAHEYLQAFQALGP-- 229 Xylella fastidiosa 9a5c
Q9JYM9 171 FLISDFGTRRRYKLAWQEHVIRtlleAAPGIVRGTSNVFL-------------AKKLGITPIGTMAHEFLQAFQALDV-- 235 Neisseria meningitidi...
Q9HUP4 171 FQVADFGTRRRFSYRTQEEVVHilkrDFPGRFVGTSNVHL-------------AREYDLKPIGTMAHEWLMAHQQLGP-- 235 Pseudomonas aeruginos...
4HL7_B 179 FSLTEXGTRRRFSSQVQRDVLAclkqEIPQWVLGTSNYHF-------------AREFDLKPIGTIAHEWFXGHQALV--- 242 Vibrio cholerae O1 bi...
P18133 169 FHLMDFGTRRRFSREVQETIVKrl--qqESWFVGTSNYDL-------------ARRLSLTPMGTQAHEWFQAHQQISP-- 231 Escherichia coli K-12
6ATB_D 264 hIVTQFSSvpvs--vvsDSYDIYNACEK-IWGEDLRHLIVSRSTQa---------pLIIRPDSGNPLDtv---------- 321 human
Q9CM44 248 nMVEQFAGehkiyavvsDSYDLWNALEN-IWGTQLKDLVEIKGGT-----------LVVRPDSGDPAEvv---------- 305 Pasteurella multocida
Q9APM3 265 yLMAKFPHnmls--ivsDTTDFWHNIT--VNLPLLKQEIIARPENa---------rLVIRPDSGNFFAiicgdptadteh 331 [Haemophilus] ducreyi
Q55929 244 nMLTQFAKpgsvlavvsDSYDLWNAIDH-LWGDHLRAQVLDSGAT-----------VVIRPDSGDPVAiv---------- 301 Synechocystis sp. PCC...
Q9RXL6 249 nMVRQFGKpgkvyavvsDSYDLKHAINV-HWGETLRKEVEESGGT-----------LVVRPDSGDPPAmv---------- 306 Deinococcus radiodurans
Q9PED1 230 -RLRDSQV---------AGLEAWAREYRgDLGIALSDVVGLDAFLgdfdlyfcklfDGMRHDSGDPFK------------ 287 Xylella fastidiosa 9a5c
Q9JYM9 236 -RLRNFQK---------AALESWVHEYRgDLGVALTDVVGMDAFLrdfdlyfaklfDGLRHDSGDPYV------------ 293 Neisseria meningitidi...
Q9HUP4 236 -RLVDSQQ---------AALDCWVREYRgQLGIALTDCITMDAFLddfdlyfaklfDGLRHDSGDPLA------------ 293 Pseudomonas aeruginos...
4HL7_B 243 -NERDSQQ---------VALERWLTAFDgXLAIAPTDTLTIDAFLndfnrhlanayDGVRHDSGCPFR------------ 300 Vibrio cholerae O1 bi...
P18133 232 -DLANSQR---------AALAAWLEEYPdQLGIALTDCITMDAFLrdfgvefasryQGLRHDSGDPVE------------ 289 Escherichia coli K-12
6ATB_D 322 --lkVLEILGKKFPVTENSKGYkllppYLRVIQGDGVDINTLQEIVEGMKQKMWsieNIAFGSGGGLLQKLTRDLLNCSF 399 human
Q9CM44 306 --crTLAILAEKFGTTLNSKGYkvlpdCVRLIQGDGINVNSLGKILEAILASGFsveNVAFGMGGGLLQQVNRDTMSWAM 383 Pasteurella multocida
Q9APM3 332 erkgLIECLWDIFGGTVNQKGYkvinpHIGAIYGDGVTYEKMFKILEGLQAKGFassNIVFGVGAQTYQRNTRDTLGFAL 411 [Haemophilus] ducreyi
Q55929 302 --aqTLERLEACFGSTLNSKGFrv-lnAVRVIQGDGVDEESISAILEKTESLGFsttNLAFGMGGALLQKVNRDTQKFAM 378 Synechocystis sp. PCC...
Q9RXL6 307 --rlAVNALAAKYGTTTNSKGFkv-lqHVRVIQGDGIDESTIRQILQNLYVDGFsaeNVTFGMGGALLQKVDRDTQRFAY 383 Deinococcus radiodurans
Q9PED1 288 ----WGERIIMHLESH-RIDPR-----TKVLVFSDGLDMNKVMRLYQHFRG-RC---RLAFGVGTSLTNDLGP------- 346 Xylella fastidiosa 9a5c
Q9JYM9 294 ----WGDKAYAHYQKL-KIDSR-----TKMLTFSDGLDIERSWALHQYFKD-RF---KTGFGIGTNLTNDMGH------- 352 Neisseria meningitidi...
Q9HUP4 294 ----WAEKAIAHYRRL-GIDPL-----SKTLVFSDGLDMPKALQLFRALRG-KI---NVSFGIGTNLTCDIPG------- 352 Pseudomonas aeruginos...
4HL7_B 301 ----WGDKXIAHYQQL-GIDPT-----TKLFIFSDGLDFDQALELCEYFAG-RV---KISFGIGTFLTNDLANWRNAAGV 366 Vibrio cholerae O1 bi...
P18133 290 ----WGEKAIAHYEKL-GIDPQ-----SKTLVFSDNLDLRKAVELYRHFSS-RV---QLSFGIGTRLTCDIPQ------- 348 Escherichia coli K-12
6ATB_D 400 KCSYVVTNGLGINVFKDPVADPN-KRSKKGRlslhrtpagnfvtleegKGDLeeygQDLLHTVFKNGK 466 human
Q9CM44 384 KASAVCIAGEWHDVYKDPITSQA-KRSKRGVlalvkqenrwhtieqkaLGQQ----KNQLRTVFLNGE 446 Pasteurella multocida
Q9APM3 412 KATSITINGEEKAIFKNPKTDDGfKKSQKGRv------------------------KVLSRDTYVDGL 455 [Haemophilus] ducreyi
Q55929 379 KCSEVTVEDKAIPVYKDPVTDPG-KTSKKGRlslvk--------tdsgYGTVptssEDLLQVVYENGH 437 Synechocystis sp. PCC 6803
Q9RXL6 384 KASAGLIDGEYRGIYKDPVTDPG-KRSKDGVldlveengrmvtrqyrtFDTDf--pGSLMRTVYRDGE 448 Deinococcus radiodurans
Q9PED1 347 --TPLQIVIKMVRCNGQPVAKLS-DSPGKSM-----------------CDDPa--yLHYLRQVFGVSA 392 Xylella fastidiosa 9a5c
Q9JYM9 353 --TPLNIVLKLVECNGQSVAKLS-DSPGKTM-----------------TNNSt--fLAYLRQVFDVPE 398 Neisseria meningitidis MC58
Q9HUP4 353 -VEPMNIVLKMTACNGHPVAKIS-DAPGKTQ-----------------CRDEn--fVAYLRHVFNVPA 399 Pseudomonas aeruginosa PAO1
4HL7_B 367 EYRPLSIVIKLAECQGRPVAKIS-DQPEKAX-----------------CEDPi--fLANLKRRFNIEL 414 Vibrio cholerae O1 biovar El Tor ...
P18133 349 -VKPLNIVIKLVECNGKPVAKLS-DSPGKTI-----------------CHDKa--fVRALRKAFDLPH 395 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap