6CFW


Conserved Protein Domain Family
MrpF_PhaF

?
pfam04066: MrpF_PhaF 
Multiple resistance and pH regulation protein F (MrpF / PhaF)
Members of the PhaF / MrpF family are predicted to be an integral membrane proteins with three transmembrane regions, involved in regulation of pH. PhaF is part of a potassium efflux system involved in pH regulation. It is also involved in symbiosis in Rhizobium meliloti. MrpF is part of a Na+/H+ antiporter complex, also involved in pH homeostasis. MrpF is thought to be an efflux system for Na+ and cholate. The Mrp system in Bacilli may also have primary energisation capacities.
Statistics
?
PSSM-Id: 397952
Aligned: 322 rows
Threshold Bit Score: 28.1178
Threshold Setting Gi: 570733901
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CFW_B                 29 DRVVAVDTLNTLIVAIMLLLGAAYERAIYIDIAIVYALLSYVGTLVIAKYL 79 
Q89DX1                 31 DRVMATQLIGTGGIATLLLLGTVASIPAAIDVALTLALLATFASIAFVKkg 81  Bradyrhizobium japonicum
PRJNA62513:MARPU_15345 31 DRMMGVQLLGTSGIGVLLLLAVAIDQPALIDVALIFALLAAVAAAALTRrr 81  Marichromatium purpuratum 984
ESQ16814               33 DRMMAAQLLGTSGIGALLLLAPVLQIPALVDVALVFALLAAVSVTAFTRrr 83  uncultured Thiohalocapsa sp. PB-PSB1
WP_012970621           33 DRLMAAQLLGTSGIGLLLVLIPVIRVPALIDVALVFSLLAAVAIVAFTRrr 83  Allochromatium vinosum
jgi:Rvan_1094          31 DRMLAAQLFGTHAVAILILLAASGSAPALFDIALVFALLAAMTAVAFVRma 81  Rhodomicrobium vannielii ATCC 17100
Q3JBL0                 36 DRMLAAQLFGTTSVAVLLLLAEAMQAPSLQNVALVLALLAAVATIAFIRHI 86  Nitrosococcus oceani ATCC 19707
jgi:Selin_1870         31 DRMLSVELFGTTTVAMLLLLAYAMDMTALLDVALLLVLLAVVATIAFVRgt 81  Desulfurispirillum indicum S5
Q0AAP4                 31 DRMLAAQLFGTTTVAVLLILAQAMELAALRDVALLFVLLATLVSVAFVRlp 81  Alkalilimnicola ehrlichii MLHE-1
WP_011813616           29 DRMLAALLFGTTTVAVLLLLAEAMALPALRDVALLFVVLAAVIAVAFTRVp 79  Halorhodospira halophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap