5OQJ


Conserved Protein Domain Family
Ssl1

?
pfam04056: Ssl1 
Click on image for an interactive view with Cn3D
Ssl1-like
Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex.
Statistics
?
PSSM-Id: 397944
Aligned: 6 rows
Threshold Bit Score: 298.184
Threshold Setting Gi: 26400388
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5OQJ_6 129 TLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNP 208 Saccharomyces cerevis...
Q9VNP8  67 VLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEP 146 fruit fly
Q9JIB4  64 VVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEP 143 house mouse
P34567  68 VIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDF 147 Caenorhabditis elegans
Q9ZVN9  87 VIDFSRAAAEMDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMGKL--EALGDS 164 thale cress
O74995  92 VLDLSNSMEERDFHHKRFDLQIKYASEFVLEFFEQNPISQLSIIGVMDGIAHRITDLHGNPQSHIQKLKSLR--DCSGNF 169 Schizosaccharomyces p...
5OQJ_6 209 SLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNyGdesFY 288 Saccharomyces cerevis...
Q9VNP8 147 SLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTM-G---TF 222 fruit fly
Q9JIB4 144 SLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETG-G---TY 219 house mouse
P34567 148 SLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATK-G---EY 223 Caenorhabditis elegans
Q9ZVN9 165 SLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLRCSVIGLSAEMFICKHLCQETG-G---LY 240 thale cress
O74995 170 SLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKTIDALVHDSIRVRIVGLAAEVAICKEICNKTNsStknAY 249 Schizosaccharomyces p...
5OQJ_6 289 KILLDETHLKELFNEAVTP 307 Saccharomyces cerevisiae S288C
Q9VNP8 223 GAVLDDAHFRDQLMSQVDP 241 fruit fly
Q9JIB4 220 HVILDETHYKELLAHHVSP 238 house mouse
P34567 224 SVALDPDHLQLLFSKHTLP 242 Caenorhabditis elegans
Q9ZVN9 241 SVAVDEVHLKDLLLEHAPP 259 thale cress
O74995 250 GVVISEQHFRELLLESTIP 268 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap