5A1U,5A1U


Conserved Protein Domain Family
Coatomer_WDAD

?
pfam04053: Coatomer_WDAD 
Coatomer WD associated region
This region is composed of WD40 repeats.
Statistics
?
PSSM-Id: 397941
Aligned: 54 rows
Threshold Bit Score: 369.634
Threshold Setting Gi: 121905481
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5A1U_D        319 HSEVQQANLKAMgdteikDGERLPLAVKDMGSCEIY--PQTIQHNP---NGRFVVV------CGDGEYIIYT-------- 379 
XP_001631811  340 DRYLRMYEFGTS-------KDVPVMQFRRNSTRTP---VHSLSFNP---AENCILLntsasnPENSVYELHAipkq---- 402  starlet sea a...
P53621        338 DRFLRQLDFNSS-------KDVAVMQLRSGSKFPV----FNMSYNP---AENAVLLctrasnLENSTYDLYTipkd---- 399  human
Q16K68        340 ERFLRELDFNTT-------TDSVVMTIRGGGKTP----VYSMSYNP---ALNAVLLctrtsnLENSTYDLYSipqk---- 401  yellow fever ...
Q6RYF4        337 DRFLRFYEYSTQ-------KEVQVAPIRRPGSVSLNqsPRTLSYSP---TENAVLIcs---dVDGGSYELFIvpkd---- 399  domesticated ...
Q55FR9        335 KKNFNSFDFQAG-------RTVSLFHISKLPSNNG---TQTMSYNQ---TERAILVss---dAEGGSYHLYKipp----- 393  Dictyostelium...
Q4Q2B0        329 QNKLHMYNFETE-------------EVTSCTVTYQFnpPTALSCCP---TTGGVMLs-----YANGGPQIEWipk----- 382  Leishmania major
Q57UT0        327 GNVLHSYNMESK-------------TESKFSLSRNLhpPLTLSCNP---VDNMAVVfy---dKDGGCASTLTipk----- 382  Trypanosoma b...
EDO08551      448 CSVVAQSVMAAL------VTYSPMPTNLKGNRDLIW--PFAIYYNHycpDKSLFLVny--vfKKQHIYEVLKrgas---- 513  Babesia bovis
Q229R4        332 RKQIKAYNFVKK-------SITVSKEFESQATIIQEn-INFFQQNPfetSQAQFLVgt--dtKEKSIYKFYLltyntnny 401  Tetrahymena t...
5A1U_D        380 -----AMALRNKSFGSAQEFAWAhdSSEYAIRES-NSIVKIfKNF-KEKk--SFKPDFGAESIYG----GFLLGVRSVN- 445 
XP_001631811  403 -idssNPEVSEGKRASGLTSVWVa-RNRFAVLDR-THTLLI-KNL-KNEvtkKVTAPA-CDMIFYag-tGSLLLRDAES- 474  starlet sea a...
P53621        400 -adsqNPDAPEGKRSSGLTAVWVa-RNRFAVLDR-MHSLLI-KNL-KNEitkKVQVPN-CDEIFYag-tGNLLLRDADS- 471  human
Q16K68        402 -dsnsQNSETDSKRSSGMTAVWVa-RNRFAVLDR-SNQLVI-KNF-KNEvtkKIQTPV-CDEIFYag-tGMLLLREPEH- 473  yellow fever ...
Q6RYF4        400 -sagrADYLQDAKKGSGGSAVFIa-RNRFAVLEKsSNQVLV-KSL-KNEivkKSPLPIATDVIYYag-tGNILCRAEDR- 473  domesticated ...
Q55FR9        394 ----kdSNTVNTKKGTGVAAIFVg-RDRFAVLDK-GNNVVI-RDL-ENEeikRCQIPFTIDWIYPsgspGTILIQSEDK- 464  Dictyostelium...
Q4Q2B0        383 --plaTRTCNVEATLKGIDGVFFg-GHKLAYVDV-SGKMCI-QNV-AKAsgkPQQTDVSCSRIFPgp-vGCVLCQSNDK- 454  Leishmania major
Q57UT0        383 --pgcTVDADVKKRLGILAALFYa-PNKCAFLDK-NKNIIL-CNA-HGDgekVIKHEKNLKALFPgp-aGYILRQTEEG- 454  Trypanosoma b...
EDO08551      514 -seynPQDNNTVLMGEAMSACFAs-RSLVVAINM-SHDVVL-HNL-EGGpvsSICVEGNVDKVFPic-sGIVLFWSKEQk 587  Babesia bovis
Q229R4        402 ddlqkEREDCKTFTGKG--AVFVs-KNKIARIKE-NRTVEI-YNFdLSTqsnPISDITDVNRVFSgp-iGNVIFSTDES- 474  Tetrahymena t...
5A1U_D        446 GLAFYDWEnTELIRRIEIQp----KHIFWSDSgELVCIATEESFFILKYLSEkvlaaqethegvtedgiedAFEVLGEIQ 521 
XP_001631811  475 -VTLFDVQqKRALASVKVSk---vRYTVWSPDmSYVALLSKHVVAICNRKLE-------------------SLCTIHE-N 530  starlet sea a...
P53621        472 -ITLFDVQqKRTLASVKISk---vKYVIWSADmSHVALLAKHAIVICNRKLD-------------------ALCNIHE-N 527  human
Q16K68        474 -VTLFDVQqLRTLAQVKIAk---cKYVVWSADmSHVALLAKHTLNICNRRLD-------------------LLCSIHE-S 529  yellow fever ...
Q6RYF4        474 -VAIFDLQqRLVLGELQASa---vKYVIWSNDmESVALLSKHAVVIANKKLV-------------------HRCTLHE-T 529  domesticated ...
Q55FR9        465 -IHMFDIQqKKMLCEIQVHg---vRYVIWSKDrNYVAFLTRDFIVLANKKLE-------------------QICMIHE-T 520  Dictyostelium...
Q4Q2B0        455 -ILLYQVAqQGAVAEATVSg---vRYAVWDKDfSKVALIAKNTVTIMTKRLK-------------------IIASVAESS 511  Leishmania major
Q57UT0        455 -MELFHVAqQSVAAEVPITe---tKYVVWDKDfTKVAFLGITTVHVMTRRLR-------------------SITFFSEPS 511  Trypanosoma b...
EDO08551      588 MLSIYNIEcQEEVYKVRVFvd-klFNVFVSPSkKLIAAVFRNKVLIYDRKLE-------------------KLASAEV-H 646  Babesia bovis
Q229R4        475 -LILYNITtKKEIGKIPMKaeykvKNAYWNKNnTMVALVAKKSIHVMNKNLG-------------------KICTINE-K 533  Tetrahymena t...
5A1U_D        522 EIVKTGLWVGD--CFIYTSSvNRLNY--YVGGEIVTIAHLDRTMYLLGYIPkdNRLYLGDKELNIVSYSLLVSVLEYQTA 597 
XP_001631811  531 IRVKSGAWEESg-VFVYTTS-NHIKYa-LTNGDHGIIRTLDLPIYITRVKG--SSVYCLDRECKTRVLGIDPTEFKFKLA 605  starlet sea a...
P53621        528 IRVKSGAWDESg-VFIYTTS-NHIKYa-VTTGDHGIIRTLDLPIYVTRVKG--NNVYCLDRECRPRVLTIDPTEFKFKLA 602  human
Q16K68        530 ARIKSGAWDESg-VFIYTTS-NHIKYa-IINGDHGIIRTLDLPIYITRVKN--SQVFCLDRECRTRVLNIDTTEYKFKLA 604  yellow fever ...
Q6RYF4        530 IRVKSGAWDENg-VFIYSTL-NHIKYc-LPNGDSGIIKTLDVPIYITKVAG--NTIAFLDRDGKNKIITVDASEYIFKLA 604  domesticated ...
Q55FR9        521 VLPKSGVWDDNg-VFIYSTS-NHLKYl-LQNGDNGTIRTLESTIYITGVKN--NKVFAIDREFKNRIIEIDTTEYVLKLS 595  Dictyostelium...
Q4Q2B0        512 ARIKSAAFDETrdVMYFTTS-NHLKYcyLRSGETSTISTLKNVVYLVRAVG--DSIYVLTRDGRVLRKELDNVELNFKLN 588  Leishmania major
Q57UT0        512 IRIKSAAFDEQrnILYYTTS-DHLKYcnLRNGECGIIQCLPSPIYLVRASG--DTVWALSRNGKVVVMELNNPELNFKLK 588  Trypanosoma b...
EDO08551      647 GKIKTAAWYENs-AVIYATD-ERMYYi-MVNGDCGVLQSIDAPIYIVRIKN--TSLHVMKRDHRCYRIEINSDEFFFKVA 721  Babesia bovis
Q229R4        534 FNVKSLIWHGN--VLIYTTI-NHLKFg-LLNGDSGIIKCIDENLKAVKVEG--NTFFGINPSAEIVTININTEELQLKKS 607  Tetrahymena t...
5A1U_D        598 VMRRDfSM------ADKVLptipkeqRTRVAHFLEKQGFKQQALTVSTDPEHRFELALQLGELKIAYQLAVEAESEQKWK 671 
XP_001631811  606 LINRKyDEvlhmvrNAKLV-------GQSIISYLQKKGYPEVALHFVKDEKTRFGLALECGNIEVALEAARALDDKACWE 678  starlet sea a...
P53621        603 LINRKyDEvlhmvrNAKLV-------GQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDKNCWE 675  human
Q16K68        605 LINRKyEEvlhmvrNARLV-------GQSIIAYLQQKGYPEVALHFVKDEKTRFGLALECGNIEVALEAAKALDDKQCWE 677  yellow fever ...
Q6RYF4        605 LLRKRyDHvmsmikNSQLC-------GQAVISYLQQKGFPEVALHFVKDEKTRFNLALESGNIQIAVASAKELDDKDHWY 677  domesticated ...
Q55FR9        596 LLQQNyNQvmtilrENRLV-------GKAIIAYLQKKGYPDV-VHFVKDDRTRFNLALDAGNIDIALSSAKILDDKDCWN 667  Dictyostelium...
Q4Q2B0        589 LQQQSyRDlirivqQGKLK-------GQALVGYLHKHGHSEIALHFVSDSLTRFNLAIECGAIDIAKATATELNQPAIWR 661  Leishmania major
Q57UT0        589 LQQQAyRDvikiirQKQLR-------GQALVGYLHKHGHDEVALYLVSDPLTRFNLAVECGAMDVAKTAALELNQPALWR 661  Trypanosoma b...
EDO08551      722 LYYKKvDTakklieAGRIH-------GNAMVAYLINKNYPSLARMIITDPMMKLEVALKFGDIEEALEDAHVIDDVETWE 794  Babesia bovis
Q229R4        608 LFDKNwEKikyymdANNKL-------GNSVISYLYKKNYSGIALNLVNDPKTKFSLAINSGNLEQAFKCAKELKDKEIWA 680  Tetrahymena t...
5A1U_D        672 QLAELAISKCQFSLAQECLHHAQDYGGLLLLATASGNASMVNKLAEGAERDGKNNVAFMSYFLQGKLDACLELLIRTGRL 751 
XP_001631811  679 SLGAAALRQGNHQVVEMAYQRTKNFDKLSFLYLITGNMEKLKKMQKIAEIRKDMSGQYHNALYTGDVEERVKILKALGQG 758  starlet sea a...
P53621        676 KLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQK 755  human
Q16K68        678 RLAQVALMQGNHQVVEMCYQRTKNFDKLSFLYLITGNLEKLKKMNKIAEIRKDVSAQYQGALLLGDVKERVSILKNCNQT 757  yellow fever ...
Q6RYF4        678 RLGIEALRQGNVGIVEYAYQRTKNFDRLAFLYLLTGYLDKVGFMSKIAGQNNNLMGQFHNALYLGDAKKRVEILENAGQL 757  domesticated ...
Q55FR9        668 RLGVEALKQGNYQVVEMAYSRTSEFDRLSFLYLLVGNLSTLKKM--ISYESSDIMSRFHFSLYLGDVEERIKILQEAGLH 745  Dictyostelium...
Q4Q2B0        662 RLADTATSFGDIQLAQFASAKAGNYYASGLLALLTGNIASVANLVNATR---DDNFKLHYSMYMDDARQRVDILCKVNQL 738  Leishmania major
Q57UT0        662 RLAEAATSYGDIHLALLAHTKTGNFHGASFLSLITGNMSALDHMVNTVR---DENFGLHYGMYLDDAHQRVKTLTNTGQL 738  Trypanosoma b...
EDO08551      795 NVGNAAMEQGNCVVAEAAYQKAKLFDKLSMLYLITGNSAKLKKMLNLCKFRNDITSTIQNAIYLGDMTELSNVLKNTKHA 874  Babesia bovis
Q229R4        681 KLAQEAIRQGDHQIIEIAYQNIKEYEKLSFLYTVCGKTEYLKKMLEISQKRGDIMSRFSNSLYLGNIEERIKILADSNQL 760  Tetrahymena t...
5A1U_D        752 PEAAFLARTYLP 763 
XP_001631811  759 PLAYLTAASHGL 770  starlet sea anemone
P53621        756 SLAYLTAATHGL 767  human
Q16K68        758 SLAYLTAKTHGL 769  yellow fever mosquito
Q6RYF4        758 PLAYVTAATHGL 769  domesticated barley
Q55FR9        746 QLAYITASIHGL 757  Dictyostelium discoideum
Q4Q2B0        739 PLAYVTAKSNGL 750  Leishmania major
Q57UT0        739 PLAYVAAKSTGL 750  Trypanosoma brucei
EDO08551      875 KLSQICENTYGI 886  Babesia bovis
Q229R4        761 ALAYLMAVAHNK 772  Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap