3DWL


Conserved Protein Domain Family
P34-Arc

?
pfam04045: P34-Arc 
Click on image for an interactive view with Cn3D
Arp2/3 complex, 34 kD subunit p34-Arc
Arp2/3 protein complex has been implicated in the control of actin polymerization in cells. The human complex consists of seven subunits which include the actin related Arp2 and Arp3, and five others referred to as p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc. This family represents the p34-Arc subunit.
Statistics
?
PSSM-Id: 397935
Aligned: 84 rows
Threshold Bit Score: 269.033
Threshold Setting Gi: 284084491
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DWL_D        52 ISLSMKCYPELVNYGTLDLLKQIYGAYV-HEPEMGYNFSILIDLQQLPATDEEKEQLAMSISMLKRNVLAAPFHRAFTKQ 130 fission yeast
O96623        50 VSVSLHAAADLLKNGGSALLKSVYGDMLqAKPEGGYDVTLVIQSSF----SGNKEELAKKVSLLKRHLVAAPFLMVFEGI 125 Dictyostelium d...
EGG21722      50 VSISFKGSQDLLKNGGATYLKAVYGAMLqAKPEQGYDITLVVDANA----SGDKEQLANKVANLKRNLMAAPFLMVFEAM 125 Cavenderia fasc...
XP_654747     55 ISVSTPCWKQLKENRSLEFLQKVYGSDL-VEADSNSEYNLILTIPE---KHDKPEEFAMNAAKLLTNMLIGPAVVLADEV 130 Entamoeba histo...
EAY05936      60 VEMKLPCWEAIKQYGAEERYKELYGKWK-VAPTDGRTHAVVVNLWE--MSAAEQKATIELIANLKPNMLGAPFLWVAKKV 136 Trichomonas vag...
XP_002110739  53 VSISIRSYAQLQQHGVDEHLATIYGNYL-TTPEEGYDVSLLFDLENLSSD---KDILIRNASLLKRNCVACVFEKYFDLQ 128 Trichoplax adha...
XP_003103123  57 LSISLKFYAELQQHGADDLLRKIYGGHMrATPESGFNVTLEYDLSALPDN---TSELVQKASALKRNCFASVFEKYFEFQ 133 Caenorhabditis ...
CDS36496      63 VSISLPFYKEIEKFGGSKVLVREYGSYLkPGAQSGTSVTLQFDCNHLPDN---LEDLATKAALLRRNCFASVFEHFFDYQ 139 Echinococcus mu...
CCD80928      57 VSIFIKFFHELKEHGVNEVLAREYGDFL-SSAEPNQSVTLCIDLEKLPSD---HNQLAHKCGLLKRNCMAAVFEKFFEYQ 132 Schistosoma man...
XP_002125714  57 VSIGLKFYKDLQDHGADELLRREYGAYYqATAEDGFSVTLVYDLTSVAKD---YKPIAKKASLLKRNCFASVFEKYFEAQ 133 vase tunicate
3DWL_D       131 AELADLarkDpenapmldkqATSQELMAIHYRD--EETIVLWPEHDRVTVVFSTKFREETDRIFGKVFLQEFVDARRRpa 208 fission yeast
O96623       126 EAKK-----------------PLPEIIAINYRT--DETFYLKPQGDNVIVIFDIAFKDADDVILSKIFLQSFVDVRKT-- 184 Dictyostelium d...
EGG21722     126 EAKK-----------------PLPETITIDYRT--DESFYIKPQGDNVTVIFDIHFKDADDVILSKIFLQAFVDVRKT-- 184 Cavenderia fasc...
XP_654747    131 KNNK-----------------ADEKLVQIDYRP--GESYWLKPNGDRLTVIFSIKFDDKDDAVFGRVFINEFSKSAAG-- 189 Entamoeba histo...
EAY05936     137 NA------------------KENFAPFEIPYRAhtGESIFLSPAEKGATAIFTIRFNDPGDRIIGNVFFGELAAARTR-- 196 Trichomonas vag...
XP_002110739 129 KQYEDQ---Gv----------QSKDFAIINYRE--DETLYIQAQKDRVVVIFSTLFKDENDIIIGKVFMQEFKEGRRG-- 191 Trichoplax adha...
XP_003103123 134 EA-------Gq----------EGHKRAVINYRE--DETMYIEAKADRVTVIFSTVFKDADDVIIGKVFLQEFREGRKA-- 192 Caenorhabditis ...
CDS36496     140 VAnas-------------spSAKILQGTIHFRS--DETMFVQAMSDRVTVIFSTRFKDLHDIVLGKVFLQEFSEAKRR-- 202 Echinococcus mu...
CCD80928     133 IKsn---------------aDSGSKRAVIHYRD--DETMYVQALADRVTVIFSTTFKDPDDLLIGKVFMQEFTEVRRR-- 193 Schistosoma man...
XP_002125714 134 AK-------G-----------EVGKRAVIHYRD--DETMYVESKKDRVTVIFSTVFKDESDVTFGKVFMQEFKESRRR-- 191 vase tunicate
3DWL_D       209 IQTAPQVLFSYrDPPLEIRDIQGIq---Kg-DDFGFVTFVLFERHF-TPQNREDCISHIQVFRNTLHFHIKASKAYMHQR 283 fission yeast
O96623       185 ISNVPSITFSQkDPPLELKGVKGVr---AgqANHGFVSFVLFPAHIkKP---QESADLIQTFRDYLHYHIKCAKGYMHTS 258 Dictyostelium d...
EGG21722     185 MTSVPSVTFSQkDPPLELKGVKGVr---Ag-VAHGFVSITLFPLHLkRA---QETADLIQTFRDYLHYHIKCSKGYMHTS 257 Cavenderia fasc...
XP_654747    190 CPSCDVVTRKNaPPPSELKTVEGLa------EDNCYISFLLEKRHLnNPQK---TLEVLMSCRNYINFHIKCSKAFLHIR 260 Entamoeba histo...
EAY05936     197 VRSAPIVAFSD-KCPGELEAFHLRpevkDg-SLFAYVSMSLLAASL-SERKRQDTSVYVPMFRDYLHYHIKCTKAFLHQK 273 Trichomonas vag...
XP_002110739 192 RQEAPQVLFSHrDPPLELRGT-SAr---Ig-DNVAYISFVLFPRHt-NPKNRQNTINVIHTFRNYLHYHIKCSKAYLHSR 265 Trichoplax adha...
XP_003103123 193 SQTAPAVLYSLgEPPLELKDLPGAr---Vg-DNVGYITFVLFPRHt-NKKTRDNTIDLIHSFRDYLHYHIKCSKVYLHTR 267 Caenorhabditis ...
CDS36496     203 YDGAPQVIYQHrDPPKELRGT-DAv---Sg-ENIFYITFVLLPRHv-SAQNRAKTIDLIHLMRTYMHYHIKCMKAYLQMR 276 Echinococcus mu...
CCD80928     194 LDRAPQVLYSHrVPPKELQGT-DAv---Is-DSVAYITFVLFPRHLsTESARNSTIDLIQTLRNYLHYHIKCSKAYMQMR 268 Schistosoma man...
XP_002125714 192 SQTAPQVLYNHkEPPMELSGL-DAa---Vg-DNIGYVTFVLFPRHt-GPNVRDNTIDLIHTFRNYLHYHIKCSKAYMHQR 265 vase tunicate
3DWL_D       284 MRKRVADFQKVLNRAKPDV 302 fission yeast
O96623       259 MRNRVESLIQVLNRAKPEP 277 Dictyostelium discoideum
EGG21722     258 MRNRVDSLIQVLNRAKPEP 276 Cavenderia fasciculata
XP_654747    261 MRNKVSHLQLVLNRAKPER 279 Entamoeba histolytica HM-1:IMSS
EAY05936     274 MRNRTALLLKILDEAKPEP 292 Trichomonas vaginalis G3
XP_002110739 266 MRARTEDFLKVLNRAKPEK 284 Trichoplax adhaerens
XP_003103123 268 MRAKTTDFLKVLNRARPEV 286 Caenorhabditis remanei
CDS36496     277 MRAKTSEFLKILNRAHPNA 295 Echinococcus multilocularis
CCD80928     269 MRAKTVEFLKVLNRAHIEH 287 Schistosoma mansoni
XP_002125714 266 MRAKTSDFLKVLNRARPED 284 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap