2IEC,2I52,2OGF


Conserved Protein Domain Family
DHNA

?
pfam04038: DHNA 
Click on image for an interactive view with Cn3D
Dihydroneopterin aldolase
Statistics
?
PSSM-Id: 397930
Aligned: 59 rows
Threshold Bit Score: 136.522
Threshold Setting Gi: 501637186
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IEC_D            10 SDRERAIFEAGITLGAIYHQFCGTPV-SPGTAEEVAKCIERAALLQPCVIDARVEVDVS--SEDTDNyGGYTEVSGRNLR 86  Methanopyru...
jgi:Igag_0278     18 SNRDRAVFEAGIALGMVIHQFMGIPIkFEEEVKLLEKVIEYAILSQPFKSEAKVSISIDi--PKDDNpYRYTTLRSRNLD 95  Ignisphaera...
jgi:Tagg_0594     15 TDRERAAFEAGIALGMVIHQFTGIPLrRREDVKILEQVIENAVKAQPFKIDAKVSINIDl--GNTDEpYEYTTLKTKNMD 92  Thermosphae...
CBRAS:TCELL_0837  14 TERDRAVFEAGLALGMVVHQFTGIPLrSNEDAEMLERLIERSILSQPYRTRAKVAIKRr-fDHKPEDpYDYSTLKTSDLD 92  Thermogladi...
WP_012608093      15 TSRDRAVFEAGIAIGMIIHQFTGIPVkRLEDIELIGKVIENAVKAQPFKEDAKIEIRIGdlSSSPGNpYSYTTLKTRHID 94  Desulfuroco...
BAJ49880          27 SDRERAVFEAGIALGALFHSLIGLPA-TTETKHILEKAFEKSFSLQPFRKSVKLKLYAVkrKHGP---YGYGSIGPRDIS 102 Candidatus ...
WP_012940269       1 -micRACFELGIKLGALFHQFIGIPV-GFENVDIVERAIESCVKLQPFVIDAKVEIVRDvlKRNISK-FGYTTLSPEMLK 77  Archaeoglob...
CGB:Asulf_02000    6 neEKIACFEAGIKLGALFHQFVGAPV-SLENARILEMAMESCMRLQPFVVSAEVKIDRErlKEMVSS-FGYISLSGELIR 83  Archaeoglob...
jgi:Arcve_0400     1 -msEKAAFEAGIKLAALFHQFIGAPV-SPENAELLERAMESCMRLQPYVVEAEVRINRKklEKALSS-YGYTSLTPEMLY 77  Archaeoglob...
jgi:Ferp_0241      1 -mRELAAFEAGIKLGALFHQFVGIPV-SFENVELVEKTMESCMKLQPYVVDAEVKIDKRklKERLSS-FNYTSLEGDMIF 77  Ferroglobus...
2IEC_D            87 VTIVTRCGEWEAVGKLEFIEELNYPLMWVE 116 Methanopyrus kandleri
jgi:Igag_0278     96 VTIVTSYGKTKVKARLRYIPELDYTLAYIE 125 Ignisphaera aggregans DSM 17230
jgi:Tagg_0594     93 VKITVKYGRAVVKAALRHIDELDYNLAYIE 122 Thermosphaera aggregans DSM 11486
CBRAS:TCELL_0837  93 VLVEVRYGRFVVRARLRRVEELDFNLAYIE 122 Thermogladius calderae 1633
WP_012608093      95 ARIVVRYNNVRVVARLRYIPELDFNLAYIE 124 Desulfurococcus amylolyticus
BAJ49880         103 ASVTVCYGAATAVAEVRYVASLGYPLMYVS 132 Candidatus Caldiarchaeum subterraneum
WP_012940269      78 AEVVVEVENVRVRGTLKWVEDMKYPYMNFe 107 Archaeoglobus profundus
CGB:Asulf_02000   84 ARVTVKVGETLARAELYWDDEKKYPMMRli 113 Archaeoglobus sulfaticallidus PM70-1
jgi:Arcve_0400    78 AKVSVEVEGERAVAVMEWDEEKNYPLMRll 107 Archaeoglobus veneficus SNP6
jgi:Ferp_0241     78 ARVKVRVENDEVEAVLEYDKKLKYPLMRll 107 Ferroglobus placidus DSM 10642
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap