3CBN


Conserved Protein Domain Family
DUF371

?
pfam04027: DUF371 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF371)
Archaeal domain of unknown function.
Statistics
?
PSSM-Id: 397921
Aligned: 65 rows
Threshold Bit Score: 162.644
Threshold Setting Gi: 74565502
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CBN_A           10 LRARGHPNVTAGHRTTFEVTVDPEIGETADCIIGVSSSDSISTLPDEXKRAIARESSLVRVILRTENGYDEIRGYGHPEL 89  Methanotherm...
jgi:Tagg_0994    12 VRAKGHPNITAKHKTTMEITKDYDLTVRGDCIIGVDADKAALDLSSKFKEALRLPGNLLYVVLESGGFREHLIAHCSRDI 91  Thermosphaer...
WP_012186769      6 IWARGHGNVKATHRNTIEITKDDYITERGDCIIACCADKAASDLDNDFKKLITSGYSLVLMIIVAGSSIDIVTGLGLSGL 85  Caldivirga m...
Q8ZYT8           31 FIARGHPNVRASNKRTLEVTKDVYLTRRGDCIIACCAEKAAGELSATVLEALMRSG-LVVLIIDAGVVWDYVIGI-TPRS 108 Pyrobaculum ...
CCC82243          8 IIARGHVNIRATNRRTLEITKDPYVTSRGDCIVACCADKAGPDLSQEVLALLRLRG-NVMVEIEVGGLSEIIIGK-TPMA 85  Thermoproteu...
Q9YDA3            7 FQAWGHPNVRATHRTTFEITSDDYLTPRGDCIIGIRSSVTPRSLPQWFKSIARSPDSIIVVVLCSEGVCDTAVGRGHPGL 86  Aeropyrum pe...
CBRAS:ASAC_0390  11 FRAKGHVNVTARHRTTIEITKEETLTPRGDCIIGVSSEASASSLPDWLRDELRNPNNAVLVVLCSSGLCDAVIGHGDPRI 90  Acidilobus s...
WP_015233027     13 FKAYGHKNVRATHKTTIEITKDDYLTTRGDCIIGIKSEVSLNDFPKWLKEDIKKGN-MILVVFCSKKNCDSLIGYGDSNL 91  Caldisphaera...
WP_013336845      9 IRAWGHVNVRARHRTTIEITRDDYLTPRGDCIIGIKADKGLSGISPELKEIIKKDGSIVIAMFVVDDYLDYVVGMGSSKL 88  Vulcanisaeta...
jgi:Smar_0721     7 IIARGHPNIKATHKTTIEITKENYLTPRGDCIIGVASNKSANDLRPELKNILKQDNTIAVFILYVGELMDYILATGSKNL 86  Staphylother...
3CBN_A           90 TLDHPTDIVCRKSDYICSRTLXIRADKAAFDLDENLVRDLRK-GRELKVEIIVE 142 Methanothermobacter thermautotrophicus...
jgi:Tagg_0994    92 GATDPRRIIIRRSNFIEPATIGVYATKAAGDLDRRLINSLKSsDAVLTVRLYVL 145 Thermosphaera aggregans DSM 11486
WP_012186769     86 RLTDERRIIVRRSGYIDNATIMLLANKAAKDLNRDLINKARD-SEPIEVILIGS 138 Caldivirga maquilingensis
Q8ZYT8          109 KPASKWRLVARKSNYVDDSTIAILADKAAYDLDRTLIRELKR-GVPVRIIVGVC 161 Pyrobaculum aerophilum
CCC82243         86 EPRNPYRLVIRKSNYVDDSTLAVQADKSAADLPRPLVSLLRK-GIIVRVKVRVW 138 Thermoproteus tenax Kra 1
Q9YDA3           87 SLGDGRRMVFRRSSFVGPETVMIGSSKAAADLRRDLIEMLRR-GAALRVGMTVV 139 Aeropyrum pernix
CBRAS:ASAC_0390  91 TASNNMKIIIRKSDYVEGSTIMVRSNKAAADLNRELISRLAH-GDDLHVYITYL 143 Acidilobus saccharovorans 345-15
WP_015233027     92 ILNNETKIIFRKSNYIEPATALIKSNKAAADLDRNLIEELKN-GGELIVMITTI 144 Caldisphaera lagunensis
WP_013336845     89 TLGNDNKLIIRRSNYIDDATLMIRANKAAIDIDRRLIDRLKK-ESPLTVYIIGV 141 Vulcanisaeta distributa
jgi:Smar_0721    87 LIQDEKKLIIRKSTYIEPATIAIRSNKAAKDIDRRIVEKLRDpNTILKIYIVGL 140 Staphylothermus marinus F1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap