2MRU,5L6M,6NKL


Conserved Protein Domain Family
MazE_antitoxin

?
pfam04014: MazE_antitoxin 
Click on image for an interactive view with Cn3D
Antidote-toxin recognition MazE, bacterial antitoxin
AbrB-like is a family of small proteins that operate in conjunction with a cognate toxin molecule. The commonly attributed role of toxin-antitoxin systems is to maintain low-copy number plasmids from one generation to the next. Such gene-pairs are also found on chromosomes and to be associated with a number of biological functions such as: reduction of protein synthesis, gene regulation and retardation of cell growth under nutritional stress. This family includes proteins from a number of different pairings, eg MazE, AbrB, VapB, PhoU, PemI-like and SpoVT. MazE is the antidote to the toxin MazF of E. coli. MazE-MazF in E. coli is a regulated prokaryotic chromosomal addiction module. MazE antidote is degraded by the ClpPA protease of the bacterial proteasome. MazE-MazF is thought to play a role in programmed cell death when cells suffer nutrient deprivation, and MazE-MazF modules have also been implicated in the bacteriostatic effects of other addiction modules.
Statistics
?
PSSM-Id: 397909
Aligned: 119 rows
Threshold Bit Score: 28.2458
Threshold Setting Gi: 74538555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2MRU_A  24 KRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDG-KLIIEPVRKE 67  Escherichia coli K-12
Q97ZI3  17 KLGSSSLFITLPKKWINKWSIKPGDKVILEALDDgSLRLIAEKAK 61  Saccharolobus solfataricus
Q5V0G5   8 TVGGGTYTVSLPKEWAESENCTAGTTVNLHTHID-GLLVIQTPES 51  Haloarcula marismortui
Q9HS09   8 VTGGSTFTVSIPKDWARDHSVEAGDEVGFHPDSG-SLLLTPIDDT 51  Halobacterium salinarum
Q5V0F9   8 VTGGSTYTVSLPKEWATENDVSAGSVVEFHAERD-LLLLAPQRDN 51  Haloarcula marismortui
O29778   8 LVGGSSYAISLPKEWISKHNLKQGDEVVLREFDE-FIVVQPQTVE 51  Archaeoglobus fulgidus
Q8ZW18   8 RVGERSFGITLPKEWVELHGLGVGSPVKIIVDRE-KITVLPGTEA 51  Pyrobaculum aerophilum
Q9YEV8  13 KLGSSSLVVTLPKEWVREMGLKQGDPVYVVVEGG-SLRIVPAVDS 56  Aeropyrum pernix
Q5V6R8  37 QLGSSTLAVTVPVDWARQHDISKGDEVIVQRDENgGSLLVVPEQP 81  Haloarcula marismortui
Q9HRB9   8 QLGPSTLAMTLPAEWARSQDVVKGDEVTV-REGGrGSLTVTPASA 51  Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap