Conserved Protein Domain Family
DUF356

?
pfam04009: DUF356 
Protein of unknown function (DUF356)
Members of this family are around 120 amino acids in length and are found in some archaebacteria. The function of this family is unknown. However it contains a conserved motif IHPPAH that may be involved in its function.
Statistics
?
PSSM-Id: 397905
Aligned: 18 rows
Threshold Bit Score: 142.01
Threshold Setting Gi: 74560862
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NZAGRC:Abm4_0978   3 LILIRGENNSKVLNAISDVEKHGGLHLTSKPRALDANIADNIVSKILKADIKNESKVAAVFSIQENPTLAISKIRSIHPP 82  Methanobrev...
Q2NF14             3 LILVRAMNKKKALNGLADIERHAKLSIIGKPRKVSLKSVHDVTKRVLKQEPRDDIKIAVLVKVQESTTTSIMNLRKIHPP 82  Methanospha...
WP_012956249       3 LILIRGENNAKILNAIADVERHANLTLETKPKKVDPKFADKLVENVLKSPLRTKSKVATAFRVKEDTTIAILQVKKIHPP 82  Methanobrev...
CDG64617           3 LILIRAENQAKLLNSLADIERHAGLKINGSPRIIKNKVADKYAKSIMKDELRSKSKIAVLISVQEDATLSILRIRKIHPP 82  Methanobact...
Q8TY52             2 FVVIRSDSYEKILTSLSDIERYAGIKILGKPRIMDPEVADTIVRELLG-EVRRRYPVAAVARVEGEPAEVIRKISEIHPP 80  Methanopyru...
Q8U0G4             5 IVLIRTDNFDKALTALADLVRYGGMKIRGTPRIIPPALSDWAFEQIVGEKPKKKVKAHVVAQIDLPASKAIGRIRDIHPP 84  Pyrococcus ...
Q5JFF5             5 IVLVRADNFQKASVALADLVRYGGMKIRGDPRIIPPALSEWVFEKVSGEKPRRKFKAHVIAQIDLPPRKAIGRLMDIHPP 84  Thermococcu...
Q6LX79             3 LLIIRGDSYEKIKNAIADVHRHAKLTILGKPRIMVPEAADEILEHIVG-NIKKPCKKACLVRIEENAPRAIDRIRKIHPP 81  Methanococc...
jgi:Maeo_0946      3 LLLIRGDNYEKIKNALADIHRHAKLTIEGKPKIMVPEAADELLKYVLG-DIKKPCINACLVKIKENAPRAIDKIRKIHPP 81  Methanococc...
Q0W258             4 FAVIRADDQTKLNTAISDLQRHGGLTFAIAPKELKPASADKILVNVMKVPLKKSCRAAALVSLNDDPGVAIDVLGRIHPP 83  uncultured ...
NZAGRC:Abm4_0978  83 AHIIVVSDEYDEiYEDLLNKMDEAKYF 109 Methanobrevibacter sp. AbM4
Q2NF14            83 VHVIVISEEYPE-YEDLNKEFSKSKIF 108 Methanosphaera stadtmanae DSM 3091
WP_012956249      83 AHIVVVSNTYDG-YRELSKIINEGKVF 108 Methanobrevibacter ruminantium
CDG64617          83 AHVVVISEEYDQ-WKALQKLFNTLPLF 108 Methanobacterium sp. MB1
Q8TY52            81 AHLIVITPRHGDvYRGIARRFGKLEEL 107 Methanopyrus kandleri
Q8U0G4            85 AHIIVIPVGSPV-HKELLRLWGTFKEL 110 Pyrococcus furiosus
Q5JFF5            85 AHVLVVPPDSEA-WTELMRLWGTFEKL 110 Thermococcus kodakarensis KOD1
Q6LX79            82 AHIVIVSERHEP-YFYLLEDLPKMPLL 107 Methanococcus maripaludis
jgi:Maeo_0946     82 AHITIISERHEP-YKYLIEDFPKMPSL 107 Methanococcus aeolicus Nankai-3
Q0W258            84 AHVIIVSSRHDV-YSKITDCITRLPDL 109 uncultured methanogenic archaeon
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap