Conserved Protein Domain Family
Mpp10

?
pfam04006: Mpp10 
Mpp10 protein
This family includes proteins related to Mpp10 (M phase phosphoprotein 10). The U3 small nucleolar ribonucleoprotein (snoRNP) is required for three cleavage events that generate the mature 18S rRNA from the pre-rRNA. In Saccharomyces cerevisiae, depletion of Mpp10, a U3 snoRNP-specific protein, halts 18S rRNA production and impairs cleavage at the three U3 snoRNP-dependent sites.
Statistics
?
PSSM-Id: 397903
Aligned: 51 rows
Threshold Bit Score: 353.159
Threshold Setting Gi: 549052130
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54X28        56 VYDTPEVFVG---S-TDKIKNSMTDIMSNLYELAKKNEstITeTDA--LDSLVTkgfDGEQIWAQLQLYNDPILQELE-S 128 Dictyostelium d...
XP_004180331   8 LTKEPTDILS-------KSSKGPLSLAKNYMDSVITLHkkEYpNSRndIDTITTkglDANQVWWQVKMVLDNVEGNLM-D 79  Tetrapisispora ...
Q6CRE2         8 LKTNPVGLLS---Q-DALESKEPLSAVKTYFDEVINLNknNGnSKTt-LDEIVVdglDANQVWWQSKIILDNVQGDIM-E 81  Kluyveromyces l...
XP_002551917   8 ISDNPISIIS---E-NEDTSTDSLRLVKTYIDDVILSQkaLDgKVL--LDEIVVeglDANQIWQQVRLVLENSGPKLM-G 80  Lachancea therm...
EMG50041       9 LQDKPQDVFK---L-KEKNNNYFNSLAKSFIDPLAKQYs--------vLDEIYIdglDSIQVYGQTKMVLDGVGEQLLgE 76  Candida maltosa...
CCE82181       9 LSANPQNVFSlfpSeSNQNENYFNKLTKEFLDPLSKDHs--------iLEQIHIdglDSTQVFGQAKIVLDNVADQLLfS 80  Millerozyma far...
XP_002173877   7 VEENPTSFLF---P-DESQGASFLDECINAFSSVSVPK-------KcpIQQIHTkgcDAWQIYNQLALATKYALDELP-D 74  Schizosaccharom...
O13910         5 INSEPTLFLF---P-NKEDSKQLVEKAIEVFSNIKIPS-------TspIQTIVTkglDNWQIYNQLALAAKYALDDLP-Q 72  Schizosaccharom...
EPY51748       7 dilEPTSFLF---P-NEQASNQLVEEAIRYFSAVKVPS-------SspIQKVVTknlDAWQVYNQLAIAAKHTLDDLP-D 74  Schizosaccharom...
CCX08914      31 ltHAPHEFLQ---PsGNAIQDAALNLVKRYMDPLMKEGggD-------LDMVYLdgfEVEQVWEQVRGVAEKMav----- 95  Pyronema omphal...
Q54X28       129 KVNDLTTNSNDLNIikqkkqqiDDEDDEdden---------eddFDDFEDEDDDEd-----------DDFNleHDD---- 184 Dictyostelium d...
XP_004180331  80 RIQELRELTTSNYIsdse-rdiDLDDEQqn-------------sSSEQMVESENEs-----------ELDInkETEd--- 131 Tetrapisispora ...
Q6CRE2        82 KIAELKVDNENDMSeessgdedDASNVEnsnemsadeapvseesAIEEEEEEAENe-----------ELVLdeEQQ---- 146 Kluyveromyces l...
XP_002551917  81 KISTIRTSLAEv----------NESDEEisss---------essEVEENKEEELEg-----------MNEFdsDESekvd 130 Lachancea therm...
EMG50041      77 KIPSIMERl-------------EEEDDEed-------------eDEEENEEENEEe-----------ENKEefEEEn--- 116 Candida maltosa...
CCE82181      81 DIPKHVSHKGEDDInvkqydevDSEDFSesesdad---nindreYAENQSDFSEEhdgnddfsesegSDEEeeEEEd--- 154 Millerozyma far...
XP_002173877  75 v---------------------DVSDEEqgsdsv----tgsaaeVSDVEYNEDEEmsvd-----genSEEEelDGE---- 120 Schizosaccharom...
O13910        73 v---------------------DVENEDeeedsi----tsfqdeDDETSHQELSDn-----------SEMNnrDDAd--- 113 Schizosaccharom...
EPY51748      75 l---------------------DVEEDRpsdees----yasedsQEENQFEALPAe-----------NPAEdvENEe--- 115 Schizosaccharom...
CCX08914      96 --------------------evPTKEEGssgegs-----dleegSEEEGGEEEEEd-----------VDMEsdEEDeeme 139 Pyronema omphal...
Q54X28       185 --------------YQESDLEDELSPQEDSLGDSDIESEELEEEEEEEEKKSNKknNKKvvttnvndkddkkkikgKNFF 250 Dictyostelium d...
XP_004180331 132 --------------KSDGVEIGNNGEGENISRAESESHSSEEELDSDEEerdlge----------------aegedEGGV 181 Tetrapisispora ...
Q6CRE2       147 --------------FSEPEPLELHEKEEDKLENESDSEPDDQFVEAQES---------------------------PQAI 185 Kluyveromyces l...
XP_002551917 131 aiittgqsaglpinNSDDEYHSEVREGHNSNRGSGDEGSEEEEGGANNSdgae--------------------eitVGPK 190 Lachancea therm...
EMG50041     117 --------------EGFEGFEEDDVEGSEEDDEEAEEPEDVEEGSDAETli------------------------nDTHT 158 Candida maltosa...
CCE82181     155 --------------ANDKYPGSEDRTSTDFAKNDEEANVDQESKDANDNv--------------------------EGFS 194 Millerozyma far...
XP_002173877 121 -------------------------------EQEDEEDEDEFQGFDDEADNAEV--DVV-----------------EKPK 150 Schizosaccharom...
O13910       114 --------------DEFLGFSGPENLEDVDESSAEDVSGDEAEIMNEEGQQIEQ-------------------------K 154 Schizosaccharom...
EPY51748     116 --------------EEFLGFSDRGDEENDHLSDENIENEDLETGNSNEEDENEQ--VQEd----------------QEPK 163 Schizosaccharom...
CCX08914     140 gvegeetfvgfgdeDKEKEGSEEEEEEKGVEIEEGSDEEDIEEHEDEEEEGKDL-------------------------V 194 Pyronema omphal...
Q54X28       251 GDVd-eNVDFFDAKEMEKFLDDEDD----NEYQRre---dqENDDDDDDVELg------------dSDEDDggldlpeae 310 Dictyostelium d...
XP_004180331 182 KDKfglNDQFFDIEEFNRQTIAADEiddmLD----------NDKEDEDEVDYfadi-------pseEDEEA--------- 235 Tetrapisispora ...
Q6CRE2       186 EDKfgvNDQFFNLDEFNRQTLEAENrsqdAD----------EEDEDDEEVDYfadv-------pseEDEEA--------- 239 Kluyveromyces l...
XP_002551917 191 KDSfglNDEFFDLEEFNRQTIDNE-----------------NTAEPDNEINYfedv-------pseEDEEV--------- 237 Lachancea therm...
EMG50041     159 KDAfglNDGFFDIDHFNKQILSMEK----DNN---------INDEDEEEIDYfgsls-----esddEEDEM--------- 211 Candida maltosa...
CCE82181     195 RDAfglNDGFFDIDKFNEQILDME-----------------DANADDEEIDYfedld-----ekddEDDEI--------- 243 Millerozyma far...
XP_002173877 151 KDAfglNDQFFDIDAFNKQTLEMEE----QDESQtialnddEDEENEDEIDVfg-----------dVDEEE--------- 206 Schizosaccharom...
O13910       155 KDAfglNDGFFDIDNFNKQTLALEE----EAVEEg------VLGDEDDGIDLlmdpde---nmedsEDESN--------- 212 Schizosaccharom...
EPY51748     164 KDVfglNDKFFDIDEFNKQTLALEE----QEDEQnh----eIGEEEEDDIDLfvdp------eeedEEEEG--------- 220 Schizosaccharom...
CCX08914     195 EDVhglNDGFFSIDDFNRQTEMLEL----QDARGd------TQQDEDDDFDFhadptgmkdegeedSDEEEermakales 264 Pyronema omphal...
Q54X28       311 mddeekhldslldkymeenaeelelerlaskskskskssttkkskSIDPSNMKFNDFFSDPNE--------------KgE 376 Dictyostelium d...
XP_004180331 236 ---------------------------------------------------IYYDDFFDKPKE--------------NkN 250 Tetrapisispora ...
Q6CRE2       240 ---------------------------------------------------LYYDDFFDKPSNk---------------K 253 Kluyveromyces l...
XP_002551917 238 ---------------------------------------------------LYYDDFFDKPSSs-------------KrK 253 Lachancea therm...
EMG50041     212 ---------------------------------------------------DYYDDFYDKPGQf-------------KqK 227 Candida maltosa...
CCE82181     244 ---------------------------------------------------AYYEDFFDRPNKqdv---------ssKeK 263 Millerozyma far...
XP_002173877 207 ---------------------------------------------GPQADSIMYEDFFGPRNPrdrrqqvqakkraaLkK 241 Schizosaccharom...
O13910       213 ---------------------------------------------GPQADSIMYEDFFGPKTAagrrelkkkkaeskRkR 247 Schizosaccharom...
EPY51748     221 ---------------------------------------------GPRADSILYEDFFGPKSAkgrrevskkkkrdaDaS 255 Schizosaccharom...
CCX08914     265 sklkdd------------------------ydededmdfdhdmdeDENANGIMYEDFFAPPAKkrsg-------kpkThK 313 Pyronema omphal...
Q54X28       377 DDDDNEFpIDYeDEEGDDDyeDEDDDDENLDKEEEDEDEEDeeenkeeikEDKEEAtLppEELSTFQKRAQKIQQRIKEL 456 Dictyostelium d...
XP_004180331 251 KAVSKKSsDKEgEEDFGNEsyGEDYYDAAMDAAKLDLFEDEtddeeeltsNKPEKK------LSTYEKQQLEIQKQIEIL 324 Tetrapisispora ...
Q6CRE2       254 SSQDRRPgPSKkAEAEEDEsfDESEYDDAMEEAKLDLFADEdddfqgsdeETAEQP------LSTFERQQLELKRQIESL 327 Kluyveromyces l...
XP_002551917 254 VTSGGDKqVKFgEHGEDFHenSDDEYDRAMESAKLDLFAEvedde-mkpeVDPVSK------LSTFQRQQLDIQRQIAQL 326 Lachancea therm...
EMG50041     228 VSHNSQDgDEDdEDDEGEEvfNEDDYDNAVGSAMLDLFAEDdketkpksaEN----------LSTFEKQQRSIQAEIAKL 297 Candida maltosa...
CCE82181     264 KDADNKFdFSDnSQSEGEGedENEEYSHAISSARKDLFDDDmsedddkesQKPAN-------MSSFEKQQQQIQAEISKL 336 Millerozyma far...
XP_002173877 242 KKRPVAEePSDdEEVAN-----VEEDEEEEDAAQTFERVRQdlfasdseeEQDDGT-----GLSAYERQKLELTKQIRAL 311 Schizosaccharom...
O13910       248 TSK-----PDFkNDVQQNV--IEENNESSDNEYATFDRVKKdlfasdeedDVSADQ------LSSYERDKARLTQQIREL 314 Schizosaccharom...
EPY51748     256 KKKKAKRvPKPeESDE------EEDQEEPQNDDNTFERVRKdlfadeeeeENENSQ-Q---LLSSYERDKARISQQIKEL 325 Schizosaccharom...
CCX08914     314 KDSWQPKnLNPeEE--------FNAIEADMDRVRRDLFDEEdqesdeemdGDPADP-M--NRRSSHQKRQAALMDQIRTL 382 Pyronema omphal...
Q54X28       457 EAQNLKKKDWTLVGESSARDRPSDSLLGE----VLDYDHTQRATPTITEETNKTIDDMIKKRILEKNFDDVIRKTEKEFK 532 Dictyostelium d...
XP_004180331 325 EEEAIAEKKWALKGEVKAKDRPEDALLTE----DLEFDRAAKPVPIITSEVTESLEDMIRRRIKNYEFDDLPRRTIHDIT 400 Tetrapisispora ...
Q6CRE2       328 EKEAVAEKKWALKGEVKARDRPEDALLTE----DLEFERTAKPVPVITAEVTETLENMIRRRIKEEDFNDLQRRVISDIS 403 Kluyveromyces l...
XP_002551917 327 EKEAVAEKKWALKGEVKAGDRPEDALLTE----DLDFERTSKPVPVITSDVTESLEDMIRRRIQQREFDDLARRVEANLN 402 Lachancea therm...
EMG50041     298 EAELVADKKWTMKGEITSNDRPQESLLDEt---DLTFDRTAKPVPVITEESTQTLEDLIRKRIKEDDFNDLPRRIITDIS 374 Candida maltosa...
CCE82181     337 ESDLVAEKKWTMKGEVSAKSRPQDSLLEDpeaiDLEFDRASKPVPIVTEDFSESIDDVIRRRIKEEQFDDLPKRYISDLE 416 Millerozyma far...
XP_002173877 312 EAENVAKKNWTLMGEASSKQRPQNSLLET----EVDFEQNAKPVPVVTEESTDTLEDLIKSRILDKNFDDIPRRLVSAVP 387 Schizosaccharom...
O13910       315 EAENVAKKSWTMMGEATSKGRPSNSLLDV----DLEFETGAKPVPVQTEETTETLEDLIKNRIISKTFDDVPKRAPVAVT 390 Schizosaccharom...
EPY51748     326 ESENVAKKPWTLIGEATSKSRPSNSLLDV----DIDFETGAKPVPVQTEETTSALEDVIKNRILEKRFDDVPRKAPSSLP 401 Schizosaccharom...
CCX08914     383 EAENVAKKQWVMGGEAKARDRPLNSLLEE----DLDFERSGKPVPVITQEFTDTIEELIKKRILASQFDEVVKRSASDVA 458 Pyronema omphal...
Q54X28       533 D-NYKKKIELSDEKNTEGLGDVYEKSYMKQVL----GVEETDELKQKHIKIYELFNKLCYKLDSLSNFQFTPKRIK-DRE 606 Dictyostelium d...
XP_004180331 401 NkPFKPKFELSDTKSTKSLAELYENDYNGTKD----EDEISEELRMAHNEITDLFNDLCYKLDALSSAHFIPKPLK-KSL 475 Tetrapisispora ...
Q6CRE2       404 GyNNKPRFELSDVKSSKSLAEIYEDDFKGVTE----DTEISEELQKSHDEISELYKDLVYKLDALSSAHFIPKPIK-KDL 478 Kluyveromyces l...
XP_002551917 403 FsSAKPQFELSDSKSSKSLAELYENDYNNIPQ----DSEVSEELKKSHAEISDLYSKLVYSLDALSSAHFIPKPAQ-KTL 477 Lachancea therm...
EMG50041     375 RfHKAPKAEVSEQKSSKSLAELYEDEYNQIDAq---QESLNEEVKKQHDEISELFTKVTHKLDALCSAHFIPKPHQlKTI 451 Candida maltosa...
CCE82181     417 KhDRRPAFELSQEKSKKTLAEIYEEEYSGAQD-----NSKSEETEKLHSEIGNLFENVTYMLDSLCSAHYIPKPHQtKTI 491 Millerozyma far...
XP_002173877 388 DfKPSQLFDLDENKPQRSLAEEYEEEYLKKSDpttfQSKEDKKVEKEHEEIKGLFNSVAHILDSLSSWHYVPAPAE-ASV 466 Schizosaccharom...
O13910       391 EfRPSELFELNENKSQRSLAEEYEEEFLKKSNadtyKSEADKKKEKEHEEIKALFSEVSRTLDSLASWHYVPPPPE-STV 469 Schizosaccharom...
EPY51748     402 EfRPSELFELDENKPQQSLADIYEEQYMKKANpdtyQSGVDKKRQDDYNEIKTLFEDVSYTLDALSSWHYIPAPAE-ANV 480 Schizosaccharom...
CCX08914     459 EkFRRGRVEIDDSKPQESLAEVYEKDHLKSTNpdenPDAADEKLQKEHKEIEGLWFDVSRKLDALTNWHFTPKPAK-PSL 537 Pyronema omphal...
Q54X28       607 LNI---TTANALTIEEKIPIAT-----SSATMIAPEEVYF-------------------KKNADEKGESELTKEERVKNR 659 Dictyostelium d...
XP_004180331 476 EVR---VETAAISMEDAQPLTL-----STSSTLAPQEIYKvgksen-------gnevrlKN-GVTISKDEMTREDKGRLR 539 Tetrapisispora ...
Q6CRE2       479 EVR---VQTAAISMEDAQPLTM-----SSGSTLAPQEIYKvgksen-------sneitlKN-GVVMSRDELSREDKNRLR 542 Kluyveromyces l...
XP_002551917 478 EVR---VQTPAINMEDAQPLTM-----STAPTLAPQEVYApgasrs-------tneislKN-GVVMSRDELSKDDKNRLR 541 Lachancea therm...
EMG50041     452 DIKvtdSSSPAISMEDAQPLHV-----SSESRLAPQEIYKigddvvkgdgvkgksqvqlKS-GLSYSKDELSREDKQRLR 525 Candida maltosa...
CCE82181     492 EIKa--SDAAEINLEDSQPAVV-----GSGSTLAPQEIYSlknkgnen---kaanqislKS-GLSYSKDELPREEKLRLR 560 Millerozyma far...
XP_002173877 467 EVV---ANAPTLSMEDVQPAAA-----SETMALAPQEIYNatqgert--------detvtrsGIAISKAEMNHQEKQARR 530 Schizosaccharom...
O13910       470 EIV---SNAPTLAMEDVQPTAA-----SDTMALAPQEVYKpsnenre--------getitrsGIAISSTEMDHQQKQARR 533 Schizosaccharom...
EPY51748     481 QVV---SNAPTLAMEEAQPTAS-----SDAMALAPQEVYQpsmdnrq--------netversGIAVSKAEMDHSEKQARR 544 Schizosaccharom...
CCX08914     538 AIV---SDVAAISMEEAQPSAAaggvaANVSMLAPQEIYKpgadkarlpigegggreivGKSGAPISTREMTSDEKKRRR 614 Pyronema omphal...
Q54X28       660 KKVKQQWRDEKDEKEAeirhk--kkvdpSF--AKKTTVAADmaHLKQAsNVTIFD 710 Dictyostelium discoideum AX4
XP_004180331 540 RSMKRKKSKAFAAREDk--------------pSKKSKKESVidTLSKAkNVTIVN 580 Tetrapisispora blattae CBS 6284
Q6CRE2       543 RAAKRKRSKLSAKRAEq--------------pRKKSKTDDVlnTLTKSkNITVID 583 Kluyveromyces lactis
XP_002551917 542 RALKRKRSKRLENQSGl--------------sQKKSKKDSViqTLSSAkNVTLID 582 Lachancea thermotolerans CBS 6340
EMG50041     526 RAGKRKKTKEFKDREEnkrqknlqntkgKNtkNNNNNNNNVvdALSNAkNITVIG 580 Candida maltosa Xu316
CCE82181     561 RANKRKRSKEHKHKAElreql------akevpEHKRQKRDTmdTLAAAkNVTVID 609 Millerozyma farinosa CBS 7064
XP_002173877 531 RRVRQKHAQKRKEMAE----------------IRRNKTSEKvaRTLESgNVQIIG 569 Schizosaccharomyces japonicus yFS275
O13910       534 RRVRRKHAEKRKQMAE----------------KRRNSGTEQvvRQLSKsNVEVIG 572 Schizosaccharomyces pombe 972h-
EPY51748     545 RRVRTKHAEKRKQLGE----------------KRRGTEKEQvvRQLSRaDVQVIG 583 Schizosaccharomyces cryophilus OY26
CCX08914     615 RREKEKIRKRNAAEGV-------------TrgEVKAGSKKDivDTLKRgNVAVIG 656 Pyronema omphalodes CBS 100304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap