5IC9


Conserved Protein Domain Family
Utp12

?
pfam04003: Utp12 
Click on image for an interactive view with Cn3D
Dip2/Utp12 Family
This domain is found at the C-terminus of proteins containing WD40 repeats. These proteins are part of the U3 ribonucleoprotein the yeast protein is called Utp12 or DIP2.
Statistics
?
PSSM-Id: 397900
Aligned: 384 rows
Threshold Bit Score: 44.0744
Threshold Setting Gi: 74950704
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IC9_A               79 AETYVLN-TLQKIKPASLHDALLVLPf-----STIPSLLTFLNLfA-QRElNVPLTCRILFFVLKTHHKQIVASR--TMr 149 Chaetomi...
Q8T2Q3              393 NDNLLLSsIK--VNFNVIQSTVKSLPs-----PYAYSLLSKLLKyLaTDNsKSLIVLPWINCIIKDHSSYLLSVPn--Ls 463 Dictyost...
WGS:AAQB:GK21367-PA 440 KDQTMIQsVLNTLDTETIQLTLERLPl-----EYVNPLVHELSQlLqGKHaSVACGLRWLRILASTHTSVLMSEDkdALr 514 Drosophi...
Q17E26              430 KDAEILRsVFSKNDPELIQRTAERVPa-----QYVSILLSELSSlMqKKTvHVATAVCWLKALIHSHASQLMALGseNLl 504 yellow f...
ETN67782            233 RDATILRsVFGRNDPEMIQQTVERIPa-----QYLGALLSEMSYlMqLKTvHVQTAVCWLKQLITVHASQLMALGasNLm 307 Anophele...
EEQ38141            396 PKKEVLRlCSSNDNEDSIKDTIRLFSqsekccDLVENLFEIVSKkVaSDPsRKSSLSIWLKWVLLAHGGYISKQEk--Le 473 Clavispo...
CCE82841            405 ADQETLNiCHSNDNEENIKDTVKMFSkv--ddQCLLKLFDIISFhVsNNPsKNSSLAVWLKWILLIHGRFIAEFPn--Qn 480 Milleroz...
Q6BMH1              411 TEEKIIRlCSSNNNDDNIKETIKLFStsesssALITKLFEIISKeVaSQPsKNSALSVWLKWLLLVHGGFIAKQPd--Qh 488 Debaryom...
EDK37251            390 EPEKLIHlCSTNNDEASIKEVVKRFSaeengsESISKLYEIVSHeVaSKPdDTAVLALWLKWILLTHGGALSKSGd--Hy 467 Meyerozy...
XP_311415           150 RDATLLKsVFAVDDAEMIQQTLERLPs-----QYVSPLLNELSHlMqMKTmHVKTAVCWLKPLISIHASQLMALGsiNLl 224 Anophele...
5IC9_A              150 ATLEKVRANLRAALRRQKDEMGFNiAALKVVSM 182 Chaetomium thermophilum var. thermophilum DSM 1495
Q8T2Q3              464 KKLSVLNTIIQDKFELHNRLSKLV-GKFELISS 495 Dictyostelium discoideum
WGS:AAQB:GK21367-PA 515 DKLGICLGIAEQRMRCLTEALQIT-GRVNLIIN 546 Drosophila willistoni
Q17E26              505 SNFGTCLGIIEYRVEHANSLSKLS-GRLGLLVS 536 yellow fever mosquito
ETN67782            308 TNFATCLGIIEYRVEHLNSLAKLR-GRLGLLID 339 Anopheles darlingi
EEQ38141            474 TSLASLQTSLDDGMKLMPKLLALQ-GRLQLLKS 505 Clavispora lusitaniae ATCC 42720
CCE82841            481 ENLRRLSEGLSDGMKLMPRLLTLK-GRLQLLQT 512 Millerozyma farinosa CBS 7064
Q6BMH1              489 DNLKTLQTGLTEGMKLMPRLLGLQ-GRLQLLKS 520 Debaryomyces hansenii
EDK37251            468 SDFKQLQKGLSKGMEQMPQLLALQ-GRLQLLRA 499 Meyerozyma guilliermondii ATCC 6260
XP_311415           225 ANFSTCLGIIEYRVEHLNSLSKLR-GRLGLLID 256 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap