Conserved Protein Domain Family
Vhr1

?
pfam04001: Vhr1 
Transcription factor Vhr1
Vhr1 is a transcription factor which regulates the biotin-dependent expression of transporters VHT1 and BIO5.
Statistics
?
PSSM-Id: 397898
Aligned: 20 rows
Threshold Bit Score: 141.675
Threshold Setting Gi: 562977943
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6BXJ8         9 RIGVTHAIRARLNFLDERLWKRFSARRLELIDTLDLSSKKASEQEELIKNVADALRVEFNYSPEYFRDFDKLVRAAVQSV 88  Debaryomyces ha...
XP_004195285   4 GSGITHTIREKLGFLDERLWRRFSARRLELIDMLELSSRKASEQEDEIRKVSEILRVEFGFPADTYPDFDKLVRAAIQSV 83  Pichia farinosa...
Q6CHK6       251 KGGVTQSIREKLNFQDEKLWKRFSSRRLDLIDSMALSSKKASEQDVEISNVANTLREEYGYPPETAADFDRLVRAGIQSV 330 Yarrowia lipoly...
CAY68179      42 KVGVTHFIRKKLNFSDETLWKQFSARRLELISLMKLSEKKASEQDEEITKCARLLLIEFQYPEENLLDFDKLVRCAIQSV 121 Komagataella ph...
ESX03643       7 RTGATSAIRKKLNFHDEILWRKFSSRRLLLVESLSLSSKKACEQDAEIAVCAQTLQQEFGFPRETLPEFDKLVRLAIQSV 86  Ogataea parapol...
XP_001528006  56 KLGVTQAIRDKLNFYDDRLWKRFSARRLELIDTLDLSSRKASEQERDIRRVAETLRIEFLYGPAYVDDFDKLVRAAVQSV 135 Lodderomyces el...
XP_001486679  16 RVGVTHYIRTKLNFFDDTLWKRFSARRLELIDALDLSCRKASEQESEIKRVAETLRLEFNYGPEYIQDFDRLVRAAIQSV 95  Meyerozyma guil...
EGV60747       9 RLGVTHAIRDKLDFHDERRWKRFSARRLELIDTLDLSSKKASEQEANITKVAEALRIEFEYSSEYFDEFDRLVRAAIQSV 88  Yamadazyma tenu...
EMG48937       6 KLGVTHAIRERLNFHDERLWKRFSARRLELIDTLDLSSRKASEQEQEIKKVAETLRAEFNYPVSYTADFNKLVRAAVQSV 85  Candida maltosa...
Q6CU27         7 PSGTTHRIREQLNFSDDKKWKQFSSRRLELIDKFNLSERKASEQDENIRQIAHILRTEFGYPTITSSEFEKLVTAAVQSV 86  Kluyveromyces l...
Q6BXJ8        89 RRNRKRSSKtK 99  Debaryomyces hansenii
XP_004195285  84 RRNRKRSYR-S 93  Pichia farinosa CBS 7064
Q6CHK6       331 RRNRKRVPR-F 340 Yarrowia lipolytica
CAY68179     122 RRNKKRSWK-K 131 Komagataella phaffii GS115
ESX03643      87 RRNKKRSQK-R 96  Ogataea parapolymorpha DL-1
XP_001528006 136 RRNRKRSHK-K 145 Lodderomyces elongisporus NRRL YB-4239
XP_001486679  96 RRNRKRSLK-Q 105 Meyerozyma guilliermondii ATCC 6260
EGV60747      89 RRNRKRSSK-S 98  Yamadazyma tenuis ATCC 10573
EMG48937      86 RRNRKRSHK-K 95  Candida maltosa Xu316
Q6CU27        87 RRNRKRSTK-T 96  Kluyveromyces lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap