5E27


Conserved Protein Domain Family
DUF348

?
pfam03990: DUF348 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF348)
This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
Statistics
?
PSSM-Id: 397889
Aligned: 378 rows
Threshold Bit Score: 28.1566
Threshold Setting Gi: 505404786
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5E27_A           27 VQLNDGGLVRTVHLPAPNVAGLLS--AAGVPLLQSDHVVPAAT 67  Mycobacterium tuberculosis
jgi:TherJR_0101 100 VNVIADGQTTKVRTPLRTVKEILR--DAEIKISPLDKVEPQLD 140 Thermincola potens JR
Q251X2           43 VTVEIDGGKQSLTTLYSTVGAALEhsRLGIY--PEDIVEPNRE 83  Desulfitobacterium hafniense Y51
CDB03118        136 ipVTADGQTNTVTTLPVTVGELLE--ELDIKVGENDIVEPAQD 176 Firmicutes bacterium CAG:145
Q65PI1          140 VHFTVDGQEKEIWTTAGTVGKLLK--DLNLELAEHDQIDPSVD 180 Bacillus licheniformis DSM 13 = ATCC 14580
WP_013171026    100 VRVSIGEDTETVWTTADTVGDLLD--DMNQEVGEHDQVEPDLN 140 [Bacillus] selenitireducens
BBP86470         68 VHLTLDGKEKTIWTTDQTVGALLK--NEKIDIGKHDQVTPGKN 108 Bacillus safensis
WP_013171026    157 VTVTSDGETEEVWTVSTTVGDLLD--AQAIELGELDRVEPEAD 197 [Bacillus] selenitireducens
WP_015008781    155 VTIKDATEEESVWTTANTVGELLE--SEAIELNELDRLEPKKE 195 Amphibacillus xylanus
WP_014901072     43 inaNIDGKQVCIRTLYGTVGQALEh-SSKIEFYPEDIVSPSID 84  Desulfosporosinus meridiei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap