Conserved Protein Domain Family
SHD1

?
pfam03983: SHD1 
SLA1 homology domain 1, SHD1
NPFXD peptides specifically interact with the SHD1 domain. NPFXD is a clathrin-facilitated endocytic targeting signal. NPFXD was originally discovered in the cytoplasmic domain of the furin-like protease Kex2p. Sla1 is thought to function as an endocytic adaptor.
Statistics
?
PSSM-Id: 397884
Aligned: 49 rows
Threshold Bit Score: 95.7467
Threshold Setting Gi: 1092930750
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006690866  582 GRSKPDPTKVRTWTDRTKSFTVEAQFLGVKDGKLNLHKVNGVKIAVPIHKMSLEDLEYVERLTGISL 648  Chaetomium thermophilum va...
XP_003037865  511 ERERPPPDQTRIWHDRTGQFRVEAAFLGVNNGKFRLHKVNGVIVEVPQEKMSAEDVRYVEKLTRgnn 577  Schizophyllum commune H4-8
EGN93071      456 kaRGPPPESTRIWHDRSGEFRVEAAFLGFSNGKLRLHKANGVVIEVPSEKMSLEDMRYVEKLSSKKn 522  Serpula lacrymans var. lac...
EKM59126      498 EKRPPPTANVRTWHDRTGQFRVDAAFLGFASGKLRLHKVNGVVIEVPSDKMSADDMKYVERAMAKQr 564  Phanerochaete carnosa HHB-...
EKM80311      498 DVKFPPADQVRTWHDRTGQFRVDAAFVGFNGGKLRLHKINGVIVEVPSDKMSVDDIKFIEKLTRKSs 564  Agaricus bisporus var. bur...
XP_007843034  515 dnGFPPAEHVRTWHDRSGQFRVDAALLNFKDGKLRLHKTNGVIVEVPSEKMSLEDMKYIEKTYNKkp 581  Moniliophthora roreri MCA ...
KEI40055      477 SERKPAADQTRIWKDRTGQFKVEAQFLGLNNGKIRLHKLNGVIIEVPVAKMSPDDIQFLQSITKRSs 543  Mixia osmundae IAM 14324
CCF49813      546 SRSKPSPNNTRMWTDRTGQFKVEAEFLGFNQGKIRLHKMNGVVIEVAVEKMSDRDIAFLEDITGKKL 612  Ustilago hordei
EKC99035      492 NRPKPNPARTRVWSDRTGQFKVEAEFLGMNGNKLRLHKMNGVIIEVPIEKMSHEDAAMIRKHLarre 558  Trichosporon asahii var. a...
Q5KFA7        555 ARSKPNPAKVRTWSDKSGQFDVEAEYLGLLNGKVRLHKLNGVIIDVPLEKMSARDTELIRRHEAKKA 621  Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap