Conserved Protein Domain Family
DAGAT

?
pfam03982: DAGAT 
Diacylglycerol acyltransferase
The terminal step of triacylglycerol (TAG) formation is catalyzed by the enzyme diacylglycerol acyltransferase (DAGAT).
Statistics
?
PSSM-Id: 112781
View PSSM: pfam03982
Aligned: 6 rows
Threshold Bit Score: 390.636
Threshold Setting Gi: 75167729
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q23067  63 HVLFNTRWWFLVPLYAVWFYYDFDTPKKASRRWNWARRHVAWKYFASYFPLRL-IKTAD-LPADRNYIIGSHPHGMFSVG 140 Caenorhabditis elegans
Q9XUW0  50 FVLFFTGQWIILGLYAVWYLYDRESPRRGGYRDNWFRNLSLHKWFAEYFPVKL-HKTAE-LDPNQNYLFGYHPHGILGVG 127 Caenorhabditis elegans
Q9N4S3  44 FFLLFTFQWHILALYACWYFYDMDSPRRGGYSSDWVRKWRVNDWFAQYFPINL-HKTAE-LSTDKNYLVGIHPHGIISMA 121 Caenorhabditis elegans
O01881  55 YMLY-TVLWPLIFLYGLWMIYDWNSPKKGAYMSNWFQRQRIHSWYANYFPVKL-HTTSD-MPEEHNYLIGYHPHGIISMA 131 Caenorhabditis elegans
Q9DCV3  92 MYTFCTDCWLIAVLYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQL-VKTHN-LLTTRNYIFGYHPHGIMGLG 169 house mouse
Q9ASU1  39 SLIFLPPSLSLMVLGLLSLFIFIPIDHRSKYGRKLAR--YICKHACNYFPVSLyVEDYEaFQPNRAYVFGYEPHSVLPIG 116 thale cress
Q23067 141 GFTAMSTNATGFEDKFPGIKSHIMTLN--GQFYFPFRREFGIMLGGIEVSKESLEYTLTKCGK-GRACAIVIGGASEALE 217 Caenorhabditis elegans
Q9XUW0 128 AWSCFGFDACNVKQVFKGIRFNICTLP--GNFTAMFRREILLSIGMIESSKESIEHVLNSEEK-GRAVVIVVGGAAEALE 204 Caenorhabditis elegans
Q9N4S3 122 AWSNFATNGTGIYEKFPGIRWNLCTLA--LQFRMAIRRELLLLTGLIDCSRESIEYVLDKCGQkGRAVVLVIGGAEEALD 199 Caenorhabditis elegans
O01881 132 AFINFATNGTGILDTLPRIRFHLCTLV--GQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKK-GKAVVLVVGGAEEALD 208 Caenorhabditis elegans
Q9DCV3 170 AFCNFSTEATEVSKKFPGIRPYLATLA--GNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGS-GNAIIIVVGGAAESLS 246 house mouse
Q9ASU1 117 V-VALC-DLTGFMPI-----PNIKVLAssAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYS----CVLVPGGVQETFH 185 thale cress
Q23067 218 AHPNKNTLTLINRRGFCKYALKFGADLVPMYNFGENDLYEQYENPKGSRLREVQEKIKDMFGLCPPLLRGRSLFNqYLIG 297 Caenorhabditis elegans
Q9XUW0 205 AHPGKHTLTLANRKGFVREAVKTGAHLVPVYAFGENDIYKQIDNPEGSKLRKIQEWGKKKMGISLPLIYGRGYFQ-MALG 283 Caenorhabditis elegans
Q9N4S3 200 AHPGYHTLTLASRKGFVREALITGAYLVPVYSFGENDVFEQMENPVGSRLRNFQEWCKSIFGISYPIFHGRGFFQ-LTFG 278 Caenorhabditis elegans
O01881 209 AHPGCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQAENPKGSTIRQFQTIMKRVLGFSPPAFYGRGVFN-YTFG 287 Caenorhabditis elegans
Q9DCV3 247 SMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSsDTWG 326 house mouse
Q9ASU1 186 MQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYL-----KLSRAIRFTPICFWG--VFGsP--- 255 thale cress
Q23067 298 LLPFRKPVTTVMGRPIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHSIPPDTHLIFQ 359 Caenorhabditis elegans
Q9XUW0 284 LLPMSRAVNVVVGAPIQVEKELDPSKEVIDEIHGVYMEKLAELFEEHKAKFGVSKDTRLVFQ 345 Caenorhabditis elegans
Q9N4S3 279 YLPFRKPIDTVVGAPIPVEKVENPTKEQIDELHTIYCQKLTELFDEHKEKYGVEKDVPLVLR 340 Caenorhabditis elegans
O01881 288 LLPFRKPINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELFEEHKTKYDVSPTTQLVIN 349 Caenorhabditis elegans
Q9DCV3 327 LVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFGLPETEVLEVN 388 house mouse
Q9ASU1 256 -LPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVG----YDLELK 312 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap