5WWL


Conserved Protein Domain Family
Nnf1

?
pfam03980: Nnf1 
Click on image for an interactive view with Cn3D
Nnf1
NNF1 is an essential yeast gene that is necessary for chromosome segregation. It is associated with the spindle poles and forms part of a kinetochore subcomplex called MIND.
Statistics
?
PSSM-Id: 397882
Aligned: 113 rows
Threshold Bit Score: 43.3808
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5WWL_N        39 KVIAVIHQQLIEFFEKSCKQEYANLIKERDLNKKLDMLDECIHDAE-------FRKLHGesevdiSNKQ-PQEILKAHLY 110 Schizosaccharom...
XP_692676     80 QLTEVMHKQFISQLQTLVQKEIATVIEEGDLQVKFEELDKLEELAK-------ETAQAaw----rP-SGvPEQDICSDLV 147 zebrafish
XP_004349953  68 hLLREGYQQLQDLLMTNMQSELDLIIKETNLTEALSQLDALQPPGSrndenieQEQYN------------SQDQVRQSTM 135 Capsaspora owcz...
XP_002609918  17 KALQSIVQQHVEHLQDSVEAEIQLVLSEEKISDLFQKLETVLNDSA-------MEEDtta---wrPSGD-PEKDLRSHTM 85  Florida lancelet
XP_781127     80 QALKSLLQQFKEQLEKSIKEEIELMIDEENLVHLFNELDKLIDGTS-------NEGNpva---wrPSGE-PEKDCQRQVY 148 purple sea urchin
XP_001637682  82 EAFSSITEQMMQNARENIETEFKLMIKQEDLVDLFGELDKIRESQM-------TDTDQDqkeawrPSGI-PSVDCQDHIM 153 starlet sea ane...
1_pfamImport   1 --IDEFNEKAMEKTVTLAQQKISEMMSENQLVERFEELEKLIEESD-------KLNRQLdrpigyQSIK-PKNDLRLHLV 70 
Q8MNT1         4 AAVDAVMARMAKSTQQKVLEKTDQMIKENSVYELFDDMEQLTRESE-------ELNKQLgremgyNPVN-AKRDVALHLS 75  Caenorhabditis ...
CAP35676     270 aEIDAIMSRMIQKTQVKVQEKTNHLIKENHILEQFDELEQLTKDSI-------ELNQEWgretgyNFVK-PKRDIALHLS 341 Caenorhabditis ...
EFO98486      43 veMNSVMKRMIQATQIKVQEKTSKLIEENGICERFDELEVLTKESE-------ELNQKLgteagyNYMK-PKRDVALYLS 114 Caenorhabditis ...
5WWL_N       111 SHKRELLDKLNQDLLDIDKENEGLSTQIAAE 141 Schizosaccharomyces pombe 972h-
XP_692676    148 SSYKKQEEYMRIQLKKLLKENAALAQKVQAG 178 zebrafish
XP_004349953 136 ALKMTARENYKEMLEKTLRENDRLAETVAIR 166 Capsaspora owczarzaki ATCC 30864
XP_002609918  86 AIKLKEREELQKRLEAHENETARLQKSVLQT 116 Florida lancelet
XP_781127    149 KEKLKEKEKLERVLQEVEAEGSRLQEVIKGQ 179 purple sea urchin
XP_001637682 154 HIKLAYKDQLQKMLQQIEQENEQLKETVLPK 184 starlet sea anemone
1_pfamImport  71 ATSQQSIIDSENEIKELESELNAIQNDVSRQ 101
Q8MNT1        76 ETAEKMLTEADAEIEKIEKELKAEEDEIARR 106 Caenorhabditis elegans
CAP35676     342 DSTDKMLEAADAEIKKLEKQLNMEEEEFDRR 372 Caenorhabditis briggsae
EFO98486     115 DSTDKILHDADREIERLVKELEKEENDLAHR 145 Caenorhabditis remanei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap