6AQE,3CZP


Conserved Protein Domain Family
PPK2

?
pfam03976: PPK2 
Click on image for an interactive view with Cn3D
Polyphosphate kinase 2 (PPK2)
Inorganic polyphosphate (polyP) plays a role in metabolism and regulation and has been proposed to serve as a energy source in a pre-ATP world. In prokaryotes, the synthesis and utilisation of polyP are catalyzed by PPK1, PPK2 and polyphosphatases. Proteins with a single PPK2 domain catalyze polyP-dependent phosphorylation of ADP to ATP, whereas proteins containing 2 fused PPK2 domains phosphorylate AMP to ADP. The structure of PPK2 from Pseudomonas aeruginosa has revealed a a 3-layer alpha/beta/alpha sandwich fold with an alpha-helical lid similar to the structures of microbial thymidylate kinases.
Statistics
?
PSSM-Id: 397878
View PSSM: pfam03976
Aligned: 8 rows
Threshold Bit Score: 346.696
Threshold Setting Gi: 1559969899
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6AQE_B  26 GLskeEGQAQTAKLAGELAEWQERLYAEGKQsLLLILQARDAAGKDGAVKKVIGAFNPAGVQITSFKQPSAEELSHDFLW 105 Deinococcus radiodura...
Q9I6Z1  92 RN---EYEKAKHDLQIELLKVQSWVKETGQR-VVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQWYFQ 167 Pseudomonas aeruginos...
Q9A2Z0   1 MSksdDDEAELVQLQLALIALQKKAIKDGDK-ILVVFEGRDAAGKDGVIARITEHLSRRATTVVALPKPTDRERSEWYFQ 79  Caulobacter vibrioides
P73537 270 QLskdDYRQRLRDSQIELRKLQAKIYQEKVP-VIALFEGWDAAGKGGAIKRLTDTLDPRSYQVNTFAAPTEEEAQFHYLW 348 Synechocystis sp. PCC...
3CZP_A 270 YLdkdAYKEQLAAEQARLAGLIRDKRFRQHS-LVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLW 348 Pseudomonas aeruginos...
O05877  32 KIsdaVYQAELFRLQTEFVKLQEWARHSGAR-LVVIFEGRDGAGKGGAIKRITEYLNPRVARIAALPAPTDRERGQWYYQ 110 Mycobacterium tubercu...
Q9I154  48 ELsrrRYFRELFRLQRELVKLQNWVVHTGHK-VVILFEGRDAAGKGGVIKRITQRLNPRVCRVAALPAPNDREQTQWYFQ 126 Pseudomonas aeruginos...
Q9KU02   3 KLdkkVYERELELLQIELVKLQEWVKQEKLK-LVVIFEGRDAAGKGGVIKTITEKLNPRVCRVAALPAPTEKEKTQWYFQ 81  Vibrio cholerae
6AQE_B 106 RIHQKAPAKGYVGVFNRSQYEDVLVTRVYDMIDDKTAKRRLEHIRHFEELLTDNATRIVKVYLHISPEEQKERLQARLDN 185 Deinococcus radiodura...
Q9I6Z1 168 RYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLTNSGILLFKYWFSVSREEQLRRFISRRDD 247 Pseudomonas aeruginos...
Q9A2Z0  80 RYVEWLPACGEAVLFNRSWYNRAGVERVMDFSTPQQQEQFLRDVPAFERMLVENGMRYVKFWLDISREEQAKRLKSRRED 159 Caulobacter vibrioides
P73537 349 RFWRRIPPGGKISIFDRSWYGRVMVERVEGFAREKEWLRAYREINELEAELTAEGYVVVKFFLHISPEEQLARFEERQNN 428 Synechocystis sp. PCC...
3CZP_A 349 RFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQXERFKEREKT 428 Pseudomonas aeruginos...
O05877 111 RYIAHLPAKGEIVLFDRSWYNRAGVEKVMGFCTPQEYVLFLRQTPIFEQMLIDDGILLRKYWFSVSDAEQLRRFKARRND 190 Mycobacterium tubercu...
Q9I154 127 RYVSHLPAGGEIVLFDRSWYNRAGVERVMGFCNDEQYEEFFRSVPEFEKMLARSGIQLLKYWFSISDAEQHLRFLSRIHD 206 Pseudomonas aeruginos...
Q9KU02  82 RYVAHLPAGGEIVLFDRSWYNRAGVEKVMGFCSDEEYQEFLRSCPEFERMLQRSGIILLKYWFSVSDEEQERRFIERINT 161 Vibrio cholerae
6AQE_B 186 PGKHWKFNPGDLKDRSNWDKFNDVYEDALT-TSTDDAPWYVVPADRKWYRDLVLSHILLGALKDMNPQFP 254 Deinococcus radiodurans R1
Q9I6Z1 248 PLKHWKLSPIDIKSLDKWDDYTAAKQAMFFhTDTADAPWTVIKSDDKKRARLNCIRHFLHSLDYPDKDRR 317 Pseudomonas aeruginosa PAO1
Q9A2Z0 160 PLKAFKTSPLDAVAQEKWDDYTKARDEMLMrTHSDIAPWICVRADHKKAARLNVIR-WLLHAAGDKKILK 228 Caulobacter vibrioides
P73537 429 PFKQYKLTDEDWRNREKWPLYDVAVNQMIArTNTPVAPWTVVPANDKYFARVQVIQTVVDAVKMELKRRG 498 Synechocystis sp. PCC 6803
3CZP_A 429 PYKRYKITEEDWRNRDKWDQYVDAVGDXVDrTSTEIAPWTLVEANDKRFARVKVLRTINDAIEAAYKKDK 498 Pseudomonas aeruginosa PAO1
O05877 191 PVRQWKLSPMDLESVYRWEDYSRAKDEMMVhTDTPVSPWYVVESDIKKHARLNMMAHLLSTIDYADVEKP 260 Mycobacterium tuberculosis H37Rv
Q9I154 207 PLKQWKLSPMDLESRRRWEAYTKAKETMLErTHIPEAPWWVVQADDKKRARLNCIHHLLQQMPYREVPQP 276 Pseudomonas aeruginosa PAO1
Q9KU02 162 PLKRWKFSPMDLESRQRWAAYSRAKDEMFAyTDTKHCPWWVVPSDDKKRARLNCISHLLSSVEYQEIEHA 231 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap