1SZQ,5MUX


Conserved Protein Domain Family
MmgE_PrpD

?
pfam03972: MmgE_PrpD 
Click on image for an interactive view with Cn3D
MmgE/PrpD family
This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.
Statistics
?
PSSM-Id: 397874
Aligned: 221 rows
Threshold Bit Score: 254.731
Threshold Setting Gi: 501040360
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SZQ_B        17 VDIVDYVXNYEISSK--VAYDTAHYCLLDTLGCGLEALEYPACKKLLGpIVP-GTVVPN-GVRVPG-T-QF-QLDPVQAA 89  Escherichia coli
NP_001071075  40 SSFGRFIQSVQPKNLtpTVLQRSKRMVLDSIGVGLVGSTTEVFDLALQ-HCQ-HMYASDdISFVYG-R-QGvKLSPTLAA 115 zebrafish
XP_019223129  37 ASFGKFIGEIKPQHLspVVLHRSKRMVLDSIGVGLIGSTTDVFELALQ-HCQ-NMYAPGdTSSVYG-R-KGiRLSPILAA 112 Nile tilapia
XP_007669774  38 NSFASFIHEVLPEHLsdTVRLRSKRMILDSIGVGLLGSTTHVFDIALK-YCQ-NMYSPNaVSSVYGrT-GL-KLSPTLAA 113 platypus
XP_019827141   8 ESFAKVIHGLKVGHLtdRVIQRSKRMVLDALGVGLLGTSTEVFHKTSG-YSK-IYSSNV-SSTVWG-Q-PElRLPPTYAA 82  zebu cattle
XP_003409373   8 ESFAKMIHGLKVEHLtdRVIQRSKRMILDTLGVGLLGTSTEVFYKAGQ-YSK-IYSSNI-SSTVWG-QpDF-RLPPTYAA 82  African savanna...
XP_002712978   8 ESFANMIHGLKVGHLtdPVIRRSKRMILDTLGVGFLGTNTEVFHIASQ-YSK-IYTSSV-SSTVWG-QpDI-KLPPTYAA 82  rabbit
XP_004175119   8 GNFAKVIHGLNANHLtdQVIQRSKRMILDTLGVGLLGTSTEVCHKVAQ-YSK-IYSSDL-SSTIWG-HlDF-RLPPVYAA 82  zebra finch
POI31101      12 SSFASFIHAVRPEHLskIVRHRSKRMILDSIGVGLVGSTTHVFDIALK-YCLeLYSSVA-VSNVYG-K-PGvKLSPTLAA 87  Chinese bamboo-...
XP_005992970  34 SSFGAFIQGIPMDQLseTVRSRSKQMILDNIGVGLVGSTTEVFEIALQ-YCQ-QMYapdpvCSVYG-RpGR-KLSPVLAA 109 coelacanth
1SZQ_B        90 FNIGAXIRWLDFNDTWLAAeWGHPSDNLGGILATADWLSRNavasgkaplTxKQVLTAXIKAHEIQGCIA----LEN-SF 164 Escherichia coli
NP_001071075 116 FVNGVAAHSMDFDDTWHPA-THPSGAVLPALLAISDMLHSNsk-----psG-LDFLTAFNVGIEIQGRLM----RFS-NE 183 zebrafish
XP_019223129 113 FVNGVATHSMDFDDTWHPA-THPSGAVLPAVLALSDMMPANnk-----psG-LDFLLAFNVGIEIQGRLL----RFS-NE 180 Nile tilapia
XP_007669774 114 FTNGVAVHSMDFDDTWHPA-THPSGAVLPALLAASQMLPVGsk-----pnG-LDLLLAFNVGIEVQGRLM----HFS-RE 181 platypus
XP_019827141  83 FVNGVAIHSMDFDDTWHPA-THPSGAVLPVLMALSEALPPSpk-----ysG-LDLLLAFNVGIEVQGRLL----RFS-KE 150 zebu cattle
XP_003409373  83 FVNGVAIHSMDFDDTWHPA-THPSGAVLPVLTALSEALPQSpk-----fsG-LDLLLAFSVGIEVQGRLM----HFS-KE 150 African savanna...
XP_002712978  83 FVNGVAIHSMDFDDTWHPA-THPSGAVLPVITALSEALPQSpk-----fsG-LDLLLAFNIGIEVQGQLMhfskEAN-NI 154 rabbit
XP_004175119  83 FVNGVAVHSMDFDDTWHPA-THPSGAVLPAVIALSEAFPQKkk-----isG-LDLLLAFNVGIEVQGRLL----HFSrEA 151 zebra finch
POI31101      88 FTNGVATHSMDFDDTWHPA-THPSGAVLPALLAASQMLPPNsk-----pnG-LDFLLAFNVGLEVQGRLM----HFS-TE 155 Chinese bamboo-...
XP_005992970 110 FVNGVAVHAMDFDDTWHPA-THPSGAVLPALLATAQMLPPNsk-----psG-LDFLLAFNVGIEVQGRLM----RFS-GE 177 coelacanth
1SZQ_B       165 NRVG----LDHVLLVKVASTAVVAEXLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKswAAGDATSRAVRLALXAK 240 Escherichia coli
NP_001071075 184 AHNIpkrfHPPSVVGTLGSAAACARLLSLDRNQASNALAIAASLAGAPMA--NAATQSKPL--HIGNASRLGLEAALLAS 259 zebrafish
XP_019223129 181 AHNIpkrfHPPSVVGTMGSAAACARLLSLDPTQSSHALAIAASLAGAPMA--NAATQSKPL--HIGNASRLGLEAALLAS 256 Nile tilapia
XP_007669774 182 AHNIpkrfHPPSVVGTLGSAAAIAKLLSLNKTQCANALAVAASLAGAPMANAATLAKPL----HIGNATRFGFEAALLAA 257 platypus
XP_019827141 151 AYDIpkrfHPPSVVGTLGSAAAASKFLGLSVTECQEALAIAVSHAGAPMANAATQTKPLHV----GNAARHGLEAAFLAM 226 zebu cattle
XP_003409373 151 ANDIpkrfHPPSVVGTLGSAAAASKYLGLSWTKCREALAIAVSHAGAPIANAATQTKPLHI----GNAARHGIEAAFLAM 226 African savanna...
XP_002712978 155 PKRF----HPPSVVGALGSAAAASKLLGLSLTKCQEALAIAVSHAGAPMANAATQTKPLHV----GNAARFGVEAAFLAM 226 rabbit
XP_004175119 152 RNIPrr-fHPPAVVGTMGSAAACAKLLALDQQECKNALAIAASYAGAPLANAATQIKPLHV----GNAAKHGLEAACLAL 226 zebra finch
POI31101     156 AHNIpkrfHPPSVVGTMGSAAATAKLLSLSMTQCTHALGIAASLAGAPMANAATQAKPLHI----GNATRLGFEAALLAA 231 Chinese bamboo-...
XP_005992970 178 AHNIpnrfHPPSVVGTLGSAAATAKLLSLNQTQCRNALAIAASLAGAPMANAATQAKPLHI----GNATRLGLEAALLAS 253 coelacanth
1SZQ_B       241 TGEXGyP--SALTA---PVWGFYDVSFKGESFRFQ-RPYG------SYVX--ENVLFKIsFPAEFHSQTAVEAAXTLYEQ 306 Escherichia coli
NP_001071075 260 RGLEA-S--PLVLDavpGVAGFSAFYEDYAPRPIGsPEEDeh--sfLIES--QDIAFKR-FPAHLGMHWIADAASVVHKT 331 zebrafish
XP_019223129 257 RGLEAsPlvLDAVA---GVAGFSAFYEDYVPQPLQ-SPSNdsh-mfLLEE--QDIGFKR-FPAHLGMHWVADAAASVHKV 328 Nile tilapia
XP_007669774 258 QDMEA-N--PLILD---DVGGCSGVSAFYGDYNPMpLPLPgrdqefLLEK--QDIAFKR-FPAHLGMHWVVDAALSARDL 328 platypus
XP_019827141 227 LGLQG-N--KRVLD---LETGFGAFYTNY-SPKVL-PDLDsh--twLLEK--QDVAFKR-FPAHLATHWVADTAASMRRH 293 zebu cattle
XP_003409373 227 LGLQG-N--KQILD---MEAGFGAFYANY-SPKVL-PSLDs----hTWLLdqQDVAFKR-FPAHLATHWVADAAASVRKH 293 African savanna...
XP_002712978 227 LGLQA-N--KQILD---LKVGFGAFYDNY-SPKVL-PNLAt----yTWLLdqQDVAVKR-FPAHLATHWVAEAAESVRKR 293 rabbit
XP_004175119 227 QGLQG-N--KQILD---VESGMGAFYTDY-NPQTL-PTLQsy--pwLLEQ--QDVAIKR-FPAHLATHWVADAASSVRRK 293 zebra finch
POI31101     232 RGMEA-N--PFILDdisGCSGFSAFYSIYQPRSLStPSEHhe---fLLEK--QDIAFKR-FPAHLGMHWVVDAALSVRNL 302 Chinese bamboo-...
XP_005992970 254 KGIEA-S--SQILDyipGCSGFSAFYSDYHPKALRySVNDhk---lLLEE--QGVAFKR-FPAHLGMHWVADAAISARNL 324 coelacanth
1SZQ_B       307 XQAAgk---tAADIEKVTIRTHEACIRIIDKKGPLNNPADRDHCIQYXVAIPLLFGRLTAADYEDNVAQDKRIDALREKI 383 Escherichia coli
NP_001071075 332 LVGLkggsisPNLVQDILLRVPLS--KYINRP-FPESEHQARHSFQFNACTALLDGEVTVQSFHPEAIQRPELHALLSRV 408 zebrafish
XP_019223129 329 LVGVgpgtisPAQVEDILLRVPKS--KYINRP-FPESEHEARHSFQFNACTALLDGEVTVQSFTPAAMGRPDLHALLSRV 405 Nile tilapia
XP_007669774 329 SIRYsgs-fsPAAIRAIVLRIPES--KYINRA-FPESEHQARHSFQFNACAALLDGQVDVGSFSLENIVRPDLTKLLAKV 404 platypus
XP_019827141 294 LVTDksp-lpIDRIERIVLRIPDV--QYVNRP-FPKSEHEARHSFQYVACAMLLDGVITVPAFHKRQINRPQVRELLGKV 369 zebu cattle
XP_003409373 294 LVKGrap-lpVNHIQKIVLRIPDVQ--YVNRP-FPDSEHEARHSFQYVACAMLLDGGVTVQSFHKSQINRPQVRQLLRKV 369 African savanna...
XP_002712978 294 LVTDrgl-lpIDHIQRIVLRIPDVPY---VNRPFPDSEHEARHSFQYVACAMLLDGDVTVPSFHHSQINRPQVRELLKKV 369 rabbit
XP_004175119 294 LVQSsenltpLDKIGKVILKVPEV--RYVNRP-SPASEHEARHSFQFVACSALLDGSMSVQSFASKNIHRPALRELLCKT 370 zebra finch
POI31101     303 FVNYags-fsPSLIRTIVLKIPVS--KYINRP-FPNSEHEARHSFQFNACTALLDGEVGLSSFTESSIHRQELRELLHKV 378 Chinese bamboo-...
XP_005992970 325 LVSSigs-fsSSMIDKIVLRIPQS--KYINRS-FPETEHQARHSFQFNACTALLDGEVTIDSFNQSNLHRPSLQELLSKV 400 coelacanth
1SZQ_B       384 NCFEDPAFTADYhdPEKRAIanaITLEFTDGTRFEEVVVEYPIGHaRRRQDGIPKLVDKFKINLARQFPtrQQQ--RILE 461 Escherichia coli
NP_001071075 409 RLEHPSDNPANF--NIMYG----EVEVTLVTGDVLRGRCDTFYGH-WRNPLSQESLHKKFRNNAGTVLSteKVErlIEAV 481 zebrafish
XP_019223129 406 RLEHPNDNPANF--NRMYG----EVQLTLVGGDIVKGRCDTFYGH-WRNPLSKDSLRKKFRSNAEVVLPseKVErlIEVV 478 Nile tilapia
XP_007669774 405 VVEHPEDNPANF--DKMYG----EVVLHLENGDILTGRCDTFYGH-WRKPLSKESLLQKFRANASHVLPesKVNaiITMV 477 platypus
XP_019827141 370 ELEHPRDNLPNF--NTLYC----EMSVALKDGSIFTERSDTFYGH-WRKPLSQKDLQEKFRTNSCRTLSchAVErlIEIV 442 zebu cattle
XP_003409373 370 ELEYPPDNLPSF--NTLYCE---VSVTLKDGATFTERSSTF-YGH-WRNPLSQKDLQEKFRANASGMLPcdKVEglIRIV 442 African savanna...
XP_002712978 370 ELEHPLDNLPSF---NTLYC---EVSVTLKGGVTFTERCDTFYGH-WRKPLSQEDLQKKFRANTSRTLPndTAEsiVKVV 442 rabbit
XP_004175119 371 QLEHPPDNTPSF--DSLYCE---VSVTLQDGNTITD-RCTTFYGH-WRKPLKKEDLEEKFQSNVLGILP--TEAmeGIIE 441 zebra finch
POI31101     379 VVEHPEDNVANF--DKMYG----EVAVLLKSGDVLTGKCDTFYGH-WRKPLSRESLLKKFRSNASHVLPeeKVEtiITMV 451 Chinese bamboo-...
XP_005992970 401 VVEHPTDNEANF--DKMYS----EVILTLRNGNILKGRCDTFYGH-WRNPLTRESLIKKFTTNTTYVLEqeNTEkiIEMV 473 coelacanth
1SZQ_B       462 VSLDRAR 468 Escherichia coli
NP_001071075 482 ESLDRsd 488 zebrafish
XP_019223129 479 EDLDQlr 485 Nile tilapia
XP_007669774 478 ENIETla 484 platypus
XP_019827141 443 ENLEDLE 449 zebu cattle
XP_003409373 443 EKLEDie 449 African savanna elephant
XP_002712978 443 EKLEDle 449 rabbit
XP_004175119 442 TVYNLEK 448 zebra finch
POI31101     452 DNLENls 458 Chinese bamboo-partridge
XP_005992970 474 ENMEDll 480 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap