1PJ2,5OU5


Conserved Protein Domain Family
Malic_M

?
pfam03949: Malic_M 
Click on image for an interactive view with Cn3D
Malic enzyme, NAD binding domain
Statistics
?
PSSM-Id: 397854
Aligned: 30 rows
Threshold Bit Score: 333.772
Threshold Setting Gi: 159114714
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PJ2_A       260 IQGTAAVALAGLLAAQKVISKP---I------SEHKILFLGAGEAALGIANLIVXSXVEN-GLSE---QEAQKKIWXFDK 326 human
XP_001707581 259 IQGTGCIAAATIAAGLRAISLK---MnrtakaSEQVYVMFGAGAGGIGVADNIASLSVSE-GYTL---EQARKQFYVIDS 331 Giardia lamblia...
Q9SIU0       310 VQGTAGVAIAGLLGAVRAQGRPmidF------PKMKIVVAGAGSAGIGVLNAARKTMARMlGNTEtafDSAQSQFWVVDA 383 thale cress
P37225       296 IQGTAGVALAGLLGTVRAQGRPltdF------ANQKIVVVGAGSAGLGVLKMALQAVSRMtG------PSADPHFFLLDK 363 potato
Q82X57       304 IQGTAAVTLAGIYASCRITHKP---F------VDLKIMLLGTGSAATGVAELLLSAFMMA-GLSE---AEARSRISFVDR 370 Nitrosomonas eu...
EPB83418     304 IQSTSSITLAGILASLKSRGMSqedL------SNERIICVGAGSAGVGVCEGIIDCMVAQ-GRVKs-rEEAYSKIYMLDQ 375 Mucor circinell...
Q9VB69       308 IQGTASVAVAGLYASKRITGKS---F------KDYTFLFAGAGEAAIGIADLTVKAMVQD-GVPI---EEAYNRIYMVDI 374 fruit fly
Q9VG31       473 IQGTASVAVAGLLASLKIKKTQ---L------KDNTLLFLGAGEAALGIANLCLMAMKVE-GLTE---EEAKARIWMVDS 539 fruit fly
Q9U296       308 IQGTAAVVVAGLLASTRITKKK---L------SQERIVFLGAGGAATGVAEMCVRQMMDE-GLSE---EEACGRIYMVDI 374 Caenorhabditis ...
Q86NT5       302 IQGTAAVGLGGLLGIQRITKKP---L------EEHVIVFAGAGSAAMGIAYLLKMELMSR-GLSE---ADAAKNIYFYDQ 368 fruit fly
1PJ2_A       327 YGLLVKGRkAK--I-----DSYQEPFTHSAPESIPD-------------TFEDAVNILKPSTIIGVAGAGRLFTPDVIRA 386 human
XP_001707581 332 QGLLTADR-DD--FvngtmPGHKLPYVRHDLSIKGHt------------TLLSVIKAVKPTCLLGLSTVGKSFTREILET 396 Giardia lamblia...
Q9SIU0       384 QGLITEGR-EN--I-----DPEAQPFARKTKEMERQglk-------egaTLVEVVREVKPDVLLGLSAVGGLFSKEVLEA 448 thale cress
P37225       364 NGLITKDR-KD--I-----DPAALPFAKAHHEIEGLglq-------egaGLAEVVKKVKPHVLLGLSGVGGIFHEEVLRA 428 potato
Q82X57       371 QGLVVTVR-EE--I-----KPRVRSFASEHAAM----------------DFVGAITAIRPDVLIGATGTAGAFDEIAIRQ 426 Nitrosomonas eu...
EPB83418     376 YGLLGNPG-VH--Lps--dEEHGHPYQPRTTKLDDRqycyvkhdlrdqmGLEELVRKVKPTVLLGLTGIQGVFSEEAVRE 450 Mucor circinell...
Q9VB69       375 DGLLTKSR-KVgnL-----DGHKIHYAKDINPMS---------------DLAEIVSTIKPSVLIGASAAAGIFTPEILRT 433 fruit fly
Q9VG31       540 RGVITRDR-PKggL-----TEHKLHFAQLHEPID---------------TLAEAVRKVRPNVLIGAAAQGGAFNQEILEL 598 fruit fly
Q9U296       375 EGLITTSRsKS--L-----GERHVKFAKDLPDTK---------------NLLEVVKTVKPGALIGASTVAGAFTEDIIKE 432 Caenorhabditis ...
Q86NT5       369 DGVLTTAR-KS--I-----PDILCVFAKNMKETK---------------SLETLVEQVKPSIIMGATSAPGLFTEKIIRT 425 fruit fly
1PJ2_A       387 XASINE---RPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLtDGRVFTPGQGNNVYIFPGVALAVILCNT 463 human
XP_001707581 397 MCEGLPtgqPPIVLALSNPTEKCECTFAECMEYTNNTAYYASGSPMPSLTLpNGTTIQPAQCNNFYVFPGIGLGAYVCRA 476 Giardia lamblia...
Q9SIU0       449 MKGSTSt--RPAIFAMSNPTKNAECTPQDAFSILGENMIFASGSPFKNVEFgNGHVGHCNQGNNMYLFPGIGLGTLLSGA 526 thale cress
P37225       429 MKESDSv--RPAIFAMSNPTNNAECCPVDAFKLAGEDIVFASGSPFANVDLgNGKIGHVNQANNMYLFPGIGLGALLSGA 506 potato
Q82X57       427 MARCQE---HPVIIALSNPTSHTECTADQAYRWSDGRAVFASGSPFAPVTL-DGRTRYPAQGNNVYIYPGIGLGMVASHA 502 Nitrosomonas eu...
EPB83418     451 MAKHHE---RPVIFPLSNPDTHAECTAEEAFKWTDGRAIFASGSPFKDVELpNGKIGRTNQCNNSYSFPGLGLGITVSRA 527 Mucor circinell...
Q9VB69       434 MADNNE---RPVVFALSNPTSKAECTAEDAYKHTDARVIFSSGSPFPPVQI-GDKTFYPGQGNNAYIFPGVGLGVICTGT 509 fruit fly
Q9VG31       599 MADINE---TPIIFALSNPTSKAECTAEEAYTYTKGRCIFASGSPFAPVTY-NNKKFYPGQGNNSYIFPGVALGVLCAGM 674 fruit fly
Q9U296       433 MARLNP---RPIIFALSNPTSKAECTAETAYRCTNGAVLFASGSPFENVEM-NGKLYKPGQGNNAYIFPGVALGAVLFRT 508 Caenorhabditis ...
Q86NT5       426 MAASHE---RPGIFAFSNPTIKSECTAEQAYKFSDGKAIYSAGSPFPPVEF-NGKRLTPGQANNCFAFPALVLATMTVLA 501 fruit fly
1PJ2_A       464 RHISDSVFLEAAKALTSQLTDEELAQ-GRLYPPLANIQEVSINIAIKVTEYL 514 human
XP_001707581 477 KKITDEMITGVSGALAQMVPEEKLRR-GELLPDLDEIREISCQCALGLIRIA 527 Giardia lamblia ATCC 50803
Q9SIU0       527 PIVSDGMLQAASECLAAYMSEEEVLE-GIIYPPISRIRDITKRIAAAVIKEA 577 thale cress
P37225       507 RNISDTMLEAAAECLASYMSDDEINR-GILYPSIDDIRDITAEVGAAVLRAA 557 potato
Q82X57       503 RLVVEHMFLATAEELANCVLPEEIER-GSIYPEIARVRDVSQKIAVKVCQVA 553 Nitrosomonas europaea
EPB83418     528 SRVTPNMFLETARTIADMATPSQLKE-GILFPGVSQLREVALNVGTRVCEVA 578 Mucor circinelloides f. circinelloides 1006PhL
Q9VB69       510 HHIPDEMFLIAAQELANFVEPSDIER-GSLYPPLSSIRNVSMNIAVGVTKCA 560 fruit fly
Q9VG31       675 LNIPEQVFLVAAERLAELVSKDDLAK-GSLYPPLSSIVSCSMAIAERIVEYA 725 fruit fly
Q9U296       509 KNIPDKLFLLAARMVAEAVSEKSLNTySRVYPRLKDIRELSVKIAVEVGEYC 560 Caenorhabditis elegans
Q86NT5       502 TRMPDEIFLLAAHELAEFPTNEEMQS-GRIYPLVKQANEVAYKIGVKVAKYL 552 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap