Conserved Protein Domain Family
Lipoprotein_16

?
pfam03923: Lipoprotein_16 
Uncharacterized lipoprotein
The function of this presumed lipoprotein is unknown. The family includes E. coli YajG.
Statistics
?
PSSM-Id: 397831
Aligned: 39 rows
Threshold Bit Score: 121.158
Threshold Setting Gi: 501524468
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012532405        42 VENAKSVICNVQVSDSRneKVKVS-SKKNGFGMEMAQivPAENVAVTFQKAIECELKARGFGLg--RENSLVTIDADLVK 118 Geobacter...
jgi:Sama_2553       52 iTSSANGRIALSTQDAR--SSNTA-VRIIKGDDPAKLmgTGESPAIQLGNLFRQSFSSKGFQL---DPAATNILELKLER 125 Shewanell...
jgi:Shew_2889       36 SQGVPAKPIAIEMIDTR--SANFI-ARFNNEGDAARLvsPSESPRRQLEQVFRDGFTKAGYRI---DPSSVNHMQLQLEK 109 Shewanell...
WP_013052618        36 QQTNSRQTLAIETIDTR--SANFI-VRFNNGADAAKLvsPSEAPRKQMDRVFRAGFTQAGYQI---DPSSVKHVQIQVEQ 109 Shewanell...
Q8EAT1              36 QQTSRPVQISLDTIDSR--NAEYV-ARFMEEGTKTRLvgPSEPPKLLLDEVFRNGFTQAGYQI---DPSATNSIQVQLEE 109 Shewanell...
Q12R62              59 QQTDSVVSLMLNTVDAR--KDAAV-VRFIEEGKIIRAvsLGEPIAKQLNQLYRQGMTQSGYQI---DPAATNSLQFQVAH 132 Shewanell...
Q07YG6              36 LQTEVDFPVLVDTIDTR--EASFV-VRFNEEGKSPRLvsASEPIRQQLDTLFRNGMNKAGYVI---DPAARNSVQFQLNY 109 Shewanell...
QianUST:TMO_0782    37 vQGASDVTLEVVGQDGRvaNRDRIsSKKNGYGMETARilAANDVVAEVANAVRTELQSLGFTL----GEGGIHVVIETQT 112 Tistrella...
Q0A8M1              37 sdEGQGITVALTVEDRR--DDPVI-GFRDGERGGEARiePYEDPALGIRRGVTRALERRGFEVvaaGVPADRRLHIALEA 113 Alkalilim...
zhongguo:B5T_03731  35 SNVGHNRSVQVVGVDSR--GKNEF-GSRGGVYDETALliPSNDIKAAIADTVRNGLQSLGFNAfnpGGDAT-TLEVRLEQ 110 Alcanivor...
WP_012532405       119 YYNDFKVGFFAGDAVAELNMGVTIKNKKGDllYSHQFVAEGIERNIQLMTGENAELALEKALNEGMQKMFADKTF 193 Geobacter bemi...
jgi:Sama_2553      126 LQSDINETMLGYEAANEIIISAYARNEQQL--FSKRYTARGTMKGPLSLDLATLELEMNKLITQLAGDIVNDPEL 198 Shewanella ama...
jgi:Shew_2889      110 LLTDVSDTTFGYQATNDIIINVIASNESKT--FTKRYTARNLVSGPFSADFATLELSVNDLLGDLTAKIINDPEL 182 Shewanella loi...
WP_013052618       110 LLTDVTESTFSFEAKSNIIINIIAKNSRQV--LTKRYSARGTLSGPFSADYAQLELEMNKLLGQLSSEIINDPEL 182 Shewanella vio...
Q8EAT1             110 LQMDVTKKTFGYEAKHSVRIAVQARNSSQE--LVKRYKAKGVLKGPLTPDFATLEMDMNKLLGQLTGEILNDPEL 182 Shewanella one...
Q12R62             133 VQTDVIDTTFGYDTKTRISITALAKNAHKT--LTKNYNVRGTNEGAFSPDFATLELEFNKLLAELNQQILNDPEL 205 Shewanella den...
Q07YG6             110 LLADVTDTTFSYESKTRLVINVLAKNSQQE--FTKSYNANGYLKGPLSPDFATLELDITKLVDKLTTEILNDEEL 182 Shewanella fri...
QianUST:TMO_0782   113 FYNDFKTGFWSGDAVAEVAFMLTATKPDGTlvYSRAYRAVGMNKDIMMASAENAAPALEEALREAVRQVVQDKAL 187 Tistrella mobi...
Q0A8M1             114 LQYERQAGVVTRGIHLEGRMSARVERGDGDr-YTGKARARSERRLVHSPSQTENEQMINEVVTRMLERLLDEAPL 187 Alkalilimnicol...
zhongguo:B5T_03731 111 LDYIPEPGSVVNRVDLNLVLQAEARRGPTT--HTGTYKSSVEHKTPFTPSLAQNRQMINDILAKAIERLLQDPEM 183 Alcanivorax di...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap