1T0P,1ZXQ


Conserved Protein Domain Family
ICAM_N

?
pfam03921: ICAM_N 
Click on image for an interactive view with Cn3D
Intercellular adhesion molecule (ICAM), N-terminal domain
ICAMs normally functions to promote intercellular adhesion and signalling. However, The N-terminal domain of the receptor binds to the rhinovirus 'canyon' surrounding the icosahedral 5-fold axes, during the viral attachment process. This family is a family that is part of the Ig superfamily and is therefore related to the family ig (pfam00047).
Statistics
?
PSSM-Id: 397829
Aligned: 5 rows
Threshold Bit Score: 128.414
Threshold Setting Gi: 62738003
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T0P_B   1 QE-FLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVAS-GMG-WAAFNLSNVTGNSRILCSVYCNGSQIT 77  human
P05362  24 PGnAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLpGNN-RKVYELSNVQEDSQPMCYSNCPDGQST 102 human
P13597  24 PGdAQVSIHPREAFLPQGGSVQVNCSSSCKEDLSLGLETQWLKDELES-GPN-WKLFELSEIGEDSSPLCFENCGTVQSS 101 house mouse
P35330  22 EKaFEVYIWSEKQIVEATESWKINCSTNCAAPDMGGLETPTNKIMLEEhPQGkWKQFLVSNVSKDTVFFCHFTCSGKQHS 101 house mouse
1ZXQ_A   1 -KvFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLNKILLDE--QAqWKHYLVSNISHDTVLQCHFTCSGKQES 77  human
1T0P_B  78 GSSNITVY 85  human
P05362 103 AKTFLTVY 110 human
P13597 102 ASATITVY 109 house mouse
P35330 102 ESLNIRVY 109 house mouse
1ZXQ_A  78 MNSNVSVY 85  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap