2WWB,1VVK


Conserved Protein Domain Family
Sec61_beta

?
pfam03911: Sec61_beta 
Sec61beta family
This family consists of homologs of Sec61beta - a component of the Sec61/SecYEG protein secretory system. The domain is found in eukaryotes and archaea and is possibly homologous to the bacterial SecG. It consists of a single putative transmembrane helix, preceded by a short stretch containing various charged residues; this arrangement may help determine orientation in the cell membrane.
Statistics
?
PSSM-Id: 397820
Aligned: 113 rows
Threshold Bit Score: 25.4093
Threshold Setting Gi: 503893601
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WWB_C            54 GMWRFYT-EDSPGLKVGPVPVLVMSLLFIASVFMLHIWG 91 
jgi:Halru_2751    15 GLVRYFDsEDDKAIRIDPKTIIVFGLLLGVVIQVLSFIS 53  Halovivax ruber XH-70
jgi:Metho_2103    16 GLMRYYE-ADKKAIHIDPKSVLVFGVVIGFAIIMLNAMY 53  Methanomethylovorans hollandica DSM 15978
WP_013036781      16 GLMRYYE-EDKRAIHLDPKAVIVFGLLCGLAVILLSASY 53  Methanohalophilus mahii
WP_013193591      17 GLMRYYE-ADKRAIHLDPKPIVIFGLAVGVGILALNASF 54  Methanohalobium evestigatum
HusnBIG:Mpsy_2197 16 GLMRYYE-ADKKAIHINPKTVVVSGVVIGLVIMILDASF 53  Methanolobus psychrophilus R15
jgi:Metfor_1829   19 GLVNYYEsEDRRAIHISPITVMVVAAAIGIIIMALEIAF 57  Methanoregula formicica SMSP
EJG06968          20 GLVNYYDsEDRRAVHINPVHVIAISVAIGVVIFLLNSFY 58  Methanofollis liminatans DSM 4140
jgi:Mpet_1210     15 GLVTYYDsEDKRAVHLSPKTVLITAAIIGIIIGALDLAY 53  Methanolacinia petrolearia DSM 11571
EHQ34502          15 GLVTYYDsEDRRAIHIPPKAVLISAAAIGIIIAVLNHLF 53  Methanoplanus limicola DSM 2279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap