Conserved Protein Domain Family
DUF334

?
pfam03904: DUF334 
Domain of unknown function (DUF334)
Staphylococcus aureus plasmid proteins with no characterized function.
Statistics
?
PSSM-Id: 112704
View PSSM: pfam03904
Aligned: 2 rows
Threshold Bit Score: 434.056
Threshold Setting Gi: 141194
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P12052   1 MALQSRNSDENEKKNENTMNMQTRSKLTGTHSQKIQKTLENEELQELKKQNKLVIKYISEMKEQQDLREKELQAIKSSLK 80  Staphylococcus aureus
P03866   2 RKGQLIMSMKDIKNNKENPNTQMNSKSTGTPSSSTQNSLNNEELSELKRQNKLIVKYLAEIQENQKIREKEQKEITSELK 81  Staphylococcus aureus
P12052  81 KTTEDFQGRGKKVHNDFVRLLQKNLNRVNAEDIEIEVRKDVYGVREEIHSMLREVKQSHEHYQKRQKQLFTGIGAMLLVF 160 Staphylococcus aureus
P03866  82 EATKDFRDKSLKIRNDFVDVLQEKLKHVDTEELKDILGRGIYKVREENDRMLQEVKRSHEHYQTRQKYLFTGIGAMLLVF 161 Staphylococcus aureus
P12052 161 MLFALIMTIGRDFMGFLHVDVLQNAIASKIKASEGFISVLWYIAYGLPYILAIGLFIWLYEWIRARFHD 229 Staphylococcus aureus
P03866 162 MLFALIMTIGSDFMSFLHVDTLQNAIAGKLKASEGFMTFVWYIAYGLPYVLAIGLFIGLYEWIRAKFHD 230 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap