3S4G


Conserved Protein Domain Family
TNV_CP

?
pfam03898: TNV_CP 
Click on image for an interactive view with Cn3D
Satellite tobacco necrosis virus coat protein
Statistics
?
PSSM-Id: 146498
View PSSM: pfam03898
Aligned: 4 rows
Threshold Bit Score: 281.378
Threshold Setting Gi: 116797
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3S4G_A   1 MAKQQNNRR-----KSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHV 75  Satellite tobacco nec...
P29151  15 VSRKGSQPAs----KQDVKQVVKSILGQSLEHKRANLLLPPTVVNTTGNIYCLTQFVIEGDGISQRTGRVINLEQMVLRY 90  Satellite maize white...
O57031   1 MTKRQKRTQttrsvRSLTTRDVRNIIRGEAETKRFVLVNTLNLNSTAGTVLNLSNGIIQGDDISQRAGDKIRMTKQILRV 80  Satellite tobacco mos...
P25879   1 MTKRQSKQSn----RKSVASQVRSIVESMAEQKRFAFLTNTNTVTTAGTVINLSNNIVQGDDLVNRTGDQIKTIHQTLLT 76  Satellite tobacco nec...
3S4G_A  76 RGTAITVSQT--F-RFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKD-VTLNCSLTGESIKDRIINLP 151 Satellite tobacco nec...
P29151  91 RRTLDTTSANsgFlRYIVFLDTQNQGTLPAITDVLSSLDVSSGYEVLNAQQNRFKFLLDeVESLCASATNLSKASTLTFN 170 Satellite maize white...
O57031  81 RATAITNSQT--F-RFIWFKDNTNRGTTPSVTEVLNSASFMAQYNPVTLLQHRFTILKD-VELDCSLSGESIKHLVMTHG 156 Satellite tobacco mos...
P25879  77 RCTGITNSQS--F-RFIWFRDNTNRGTTPAVTEVLDSASITSQYNPTTFQQKRFTVFQD-FMLDTSIVGRVIVHRTAVDK 152 Satellite tobacco nec...
3S4G_A 152 GQ-LVNYNGATAVAASNGPGAIFMLQIGDSLVG--LWDSSYEAVYTDA 196 Satellite tobacco necrosis virus 1
P29151 171 QKvQVHYGGAADAATSNRRNAVFFLELSDKVATgpQTRLGVQLKFTDA 218 Satellite maize white line mosaic virus
O57031 157 GT-SCFYNGTTAVASANGPGAIFLLVIGDSIVG--TWDVGYEAHYLDL 201 Satellite tobacco mosaic virus
P25879 153 KRrAIFYNGAASVAASNGPGATFVLVIGSHATG--QYDVTAEIVYLDM 198 Satellite tobacco necrosis virus 2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap