3AHG


Conserved Protein Domain Family
XFP

?
pfam03894: XFP 
D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
Bacterial enzyme splits fructose-6-P and/or xylulose-5-P with the aid of inorganic phosphate into either acetyl-P and erythrose-4-P and/or acetyl-P and glyeraldehyde-3-P EC:4.1.2.9, EC:4.1.2.22. This family is distantly related to transketolases e.g. pfam02779.
Statistics
?
PSSM-Id: 397811
Aligned: 143 rows
Threshold Bit Score: 172.302
Threshold Setting Gi: 154157842
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3AHG_A        433 RALGAYCRDIIKNNPD--SFRIFGPDETASNRL-----NATYEVTD---KQWDNGYLsgLV--DEHMAV-TGQVTE-QLS 498
jgi:Fbal_3410 397 NKMGEWMRDAFRLNSKqrNLRIFSPDETYSNQL-----QAVFEETD---RAWQWPIEp-W---DQDMAR-DGRVME-LLS 462 Ferrimonas bal...
EHY55943      437 avgASFLEEALTRNKG--LLRIFSPDGVASCRLphqlpNRTFQALQ---R-------------DDDSAPvRGQVVE-FMS 497 Exophiala derm...
Q9HY13        433 AALDRFYTELVEANPDl-RARVGNPDELASNRL-----GGVLKALKhrvSEp-------ESe-LESV---SGRVITaLNE 495 Pseudomonas ae...
CCU73100      439 AALDSYFVDLVEVNPQl-RVRVGNPDELSSNRM-----NQTLDLLKhrvTTp-------EVgnPEAI---DGCVITaLNE 502 Thalassolituus...
WP_011804781  437 aALDQTFAGIVAGNPGl-RPRVGNPDELRSNRM-----DHTLDLLKhrvLQp-------EAgvAESV---NGAVVTaLNE 500 Acidovorax sp....
jgi:Rvan_2703 445 SAVDRFFVDLVKANPNl-RPRVGNPDELGSNQM-----GLTLAHLKhrvNVp-------EEgvPEST---EGAIITaLNE 508 Rhodomicrobium...
jgi:Plav_3459 420 SALDRWFVELVQANPQl-RIRIGNPDELASNKM-----GATLALLRhrvNVp-------EPgaPEST---DGSVVTaLNE 483 Parvibaculum l...
Q11BI0        417 haVDRWFVRVVDANPGl-RPRVGNPDELRSNHM-----GAALDRLRhrvNAs-------EPgvADAV---DGAVITaLNE 480 Chelativorans ...
jgi:Tter_2545 444 agIDAYFCRVLRANPEl-RPRVGNPDEMRSNRM-----HATLEMLKhrvTDp-------EPhvPEAV---DGKVITaLNE 507 Thermobaculum ...
3AHG_A        499 EHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATvREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGV 578
jgi:Fbal_3410 463 ENLLFGMLHGYTVTGRHGMFPTYEAFAQVVSSMCDQYCKYVYAS-QGVPFRKPVPACNVVLSSLLERQDHNGYSHQNPSL 541 Ferrimonas bal...
EHY55943      498 EHTCQGLLQGYTMTGRTGILAADESLFPVIATMVTQYSRFLRIL-KDTPWRKDVSSLNYITTGTWTRPETNGLSHPNPSF 576 Exophiala derm...
Q9HY13        496 EAVVSACLAN--QGGLN-LVASYEAFCVKMLGAVRQTLIFARQQ-KEVGRPAGWLGWPLVATSHTWENGKNQQSHQDTTF 571 Pseudomonas ae...
CCU73100      503 EAVVSACLAN--QGGLN-LVVSYEAFAAKMLGALRQALIFSRHQ-KEQGDPAGWLGLPVISTSHVWENGKNEQSHQDPVL 578 Thalassolituus...
WP_011804781  501 EAVVSAALGN--KGGIN-LVVSYEAFAVKMLGALRQEILFARHQ-ALAGQPPKWLSVVTLATSHTWENGKNEQSHQDPTL 576 Acidovorax sp....
jgi:Rvan_2703 509 EAVIGAALGN--KGGLN-LSVSYEAFAVKMLGALRQDIIFARHQ-KHLGKKPGWIGVPVIATSHAWENGKNEQSHQDPTL 584 Rhodomicrobium...
jgi:Plav_3459 484 EAVAAAALAN--KGGLN-LIVSYEAFAVKMLGLMRQEIIFARRQ-KELGQPPGWISVPLIVTSHTWENSKNEQSHQDPTI 559 Parvibaculum l...
Q11BI0        481 EAVAGAALAN--KGGIN-LIVSYEAFAMKMLGGLRQEIVFSRRQ-RETGQEPGWISVPLVVTSHTWENSKNEQSHQDPTI 556 Chelativorans ...
jgi:Tter_2545 508 EAVVSAALAN--KGGIN-LVVTYEAFAVKMLGAIRQELIFARHQ-REAGYDPGWLSVPVVLTSHTWENAKNEQSHQDPTL 583 Thermobaculum ...
3AHG_A        579 TSLLINKtfnNDHVTNIYFATDANMLLAISEKCFKS 614
jgi:Fbal_3410 542 LGAMLEK---HPTIISAYLPADGNSTLCYTEKAFDd 574 Ferrimonas balearica DSM 9799
EHY55943      577 IGSILNL---KPAIGRVYLPPDANTFLSTMAHCLRS 609 Exophiala dermatitidis NIH/UT8656
Q9HY13        572 CEALLGE---MSDMVRVLFPADHNSALALLPtiyrs 604 Pseudomonas aeruginosa
CCU73100      579 AEALLGE---MTDMARVVFPADANSAMTCLKACygd 611 Thalassolituus oleivorans MIL-1
WP_011804781  577 AEALLGE---MSDVSRVLFPVDANSAVAAMRaayrt 609 Acidovorax sp. JS42
jgi:Rvan_2703 585 AEALLGE---MSDTSRVLFPVDANTAVeamrtiyrd 617 Rhodomicrobium vannielii ATCC 17100
jgi:Plav_3459 560 GEALLGE---MSDTARVLFPVDANTACAAlravyas 592 Parvibaculum lavamentivorans DS-1
Q11BI0        557 GEALLGE---MSDTARVLFPVDANSAMAALrsvyeg 589 Chelativorans sp. BNC1
jgi:Tter_2545 584 AEALMGE---MSDVSRVVFPADWNTASATlraaygt 616 Thermobaculum terrenum ATCC BAA-798
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap