Conserved Protein Domain Family
DUF331

?
pfam03889: DUF331 
Domain of unknown function
Members of this family are uncharacterized proteins from a number of bacterial species. The proteins range in size from 50-70 residues.
Statistics
?
PSSM-Id: 397808
Aligned: 54 rows
Threshold Bit Score: 60.2229
Threshold Setting Gi: 122512705
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rahaq2_0390  3 HYKHQKGVIQDNALQALLHDPLFKQRVEKNEKGKGSYRRKEKNG 46  Rahnella aquatilis CIP 78.65 = ATCC 33071
WP_053907180     3 KYQHQKGIIQKNALEALLHDPLFKQRIEKNKKGKGSYQRKRKYS 46  Moellerella wisconsensis
Q7MYH8           3 TYHHKKGVIKDNALEALLRDPLFKQRVEKNKKGKGSYQRKEKHS 46  Photorhabdus laumondii subsp. laumondii
KYP88084         3 VYQHKKGVIRDNALEALLHDPLFKPRVEANTKGKGSYRRRDKHA 46  bacteria symbiont BFo1 of Frankliniella occidentalis
CAL18920         3 TYRHTKGKIKDNALEALLHDPLFRQRIEKNSKGKGSYQRKEKYA 46  Yersinia pestis CO92
WP_002438682     3 SYKHTRGKINDNAIEALLHDPLFKQRIERNVKGKGSYQRKGKHK 46  Atlantibacter hermannii
KFC93846         3 SYKHKKGKIRHNALEALLHDPLFHQRIEKAEKGKGSYRRKEKHA 46  Leminorella grimontii ATCC 33999 = DSM 5078
Q6CZZ7           3 TYRHKRGKIQNNAIEALLHDPLFRQRIEVNEKGKGSYRRKDKHM 46  Pectobacterium atrosepticum
WP_024912191     3 KYRHTKGQIQENAIEALLHDPLFRQRVEKNIKGKGSYRRKDKHT 46  Chania multitudinisentens
WP_013027458     3 SYRHTKGQIQDNALQALLHDPLFRQRVEQKQKGKGSFKRKAKHG 46  Pantoea ananatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap