2IQI


Conserved Protein Domain Family
ABC_trans_aux

?
pfam03886: ABC_trans_aux 
Click on image for an interactive view with Cn3D
ABC-type transport auxiliary lipoprotein component
ABC_trans_aux is a family of bacterial proteins that act as auxiliarires to the ABC-transporter in the gamma-hexachlorocyclohexane uptake permease system in Sphingobium japonicum. Gamma-hexachlorocyclohexane, or Lindane, can be used as the sole source of carbon in S.japonicum in aerobic conditions. Lindane is an insecticide.
Statistics
?
PSSM-Id: 397805
Aligned: 62 rows
Threshold Bit Score: 75.8078
Threshold Setting Gi: 501368064
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IQI_F           15 PTVRVTPNPAWPQv-sWQLLVAKPSAARIIDSPRINVRPTPGELQVYHGAGWAQPATDMLEDSVVRAFEDSGKIAAVARI 93  Xanthomonas ...
Q87N56           34 AETKTSNQMSVAEr--PLLVIRPAQLASYLNDNSIVYRTSDTQIVQAKRHQWAQSISEQITQRVVAELRQKQSDYWPVEM 111 Vibrio parah...
Q9KR87           33 PELSEHIQPKTL----PLLVVQPVELAAYLDTQGIVYRQSETQVIQARQNQWAQRLSPQLTQRITNDLRRKQSRYWPAPL 108 Vibrio cholerae
Q3J7M0           33 PPAGTTPPSEARVa-rKALIVNQIYAAEFLQHSGIVYKTAPNRLSVARQHRWAAPLTVQLHQYIYNRLTTQLPSIAVYPN 111 Nitrosococcu...
Q3IC12           34 PIVASSRDVSATD---AQLRVQTVVLRGALNNRGIAMKIDHNQIHAANYHLWGESPDSMLTVSAQQTLFNALPNWMVIKG 110 Pseudoaltero...
Q1QVZ8           50 PLSDDRAAAEAVGdfdGSVWLSPLSLTSYLDDQGIVMQLDDIRIHQARHHLWAEPLDSQLMRQLRERLSTALPEADILRR 129 Chromohaloba...
jgi:Mmwyl1_2931  35 TGLHNTQVQVTKK---ISVQLMPIVVANYLAGNEIVLVTKQGDVHRSQSNLWAESLSPQLTRLTQQRLEKALPNITWFGG 111 Marinomonas ...
Q15V64           32 DAPLITINNPEIE---KVVILDKIQLADYLKRPNLVMQIQGNKLYYSDVDLWAESLQNGIHDTMLAWLNQHAEATRFVAY 108 Pseudoaltero...
Q5LU10           27 ITGVETYRTSART-----IQVTRMDLPAYVSDSEITLLGEDGVLRPTKTGFWADEPERALTEMLAAGLDQALNA-SVAAD 100 Ruegeria pom...
Q1GM15           29 ATPAERVKNLSAR----TVEVQLVSLPSYASASDIVSEGDGGALYSQERAQWADDPARGMSVAIARGLSDRTGA-AVAVE 103 Ruegeria sp....
2IQI_F           94 Ga-----GIRSDYKLAIDVRRFESDyAGQslpaATIELNAKLLHs-------sDQrVVASRTFTVARPSSSTdTAAVAAA 161 Xanthomonas ...
Q87N56          112 Nnl---lDQSGESKLQLTLNKFNGSyQGN----AEIEGEWLLIDa-------sGN-VVRSSQVKILMPLQDEgYDALVDA 176 Vibrio parah...
Q9KR87          109 Nas---sIQQEHWKLQVRLQRFNGVyTGN----AEVAGNWELLNp-------kGE-SMLNQEFSFQVPLKDTgYPALVEA 173 Vibrio cholerae
Q3J7M0          112 Ts----sAPLKAWQLTVEFNSFHGRfDGK----AVVAGSWRLRNg-------nGD-VVAQSSFKQDTPLAEDgYEALVAA 175 Nitrosococcu...
Q3IC12          111 LpvitelDQQTFYELEYEIHHFNGDlQGN----ADISGLWRLYYthp----etGRrLLSLHNFANVTQLDGDgYDALVAT 182 Pseudoaltero...
Q1QVZ8          130 Gqt--aqAASPALHVDLRVERFQGRdDGM----AVVGGDWRIRDa-------qDR-TLSRESFAIERPLDSDgYPALVRA 195 Chromohaloba...
jgi:Mmwyl1_2931 112 Qr----lPSYAIALLNIEVDDFYADlEGM----IHISGRWQVISa-------tGE-LSASNTFEVQRKLKSDgYSTMVQT 175 Marinomonas ...
Q15V64          109 Dsp---eANLGQEHLILSVQYFMPTdQGT----VISSGQFWRTGngrtdagknGK-SVSTNSFSFTSPLTQKgYSHSVAL 180 Pseudoaltero...
Q5LU10          101 Pwp---fEGLADIQVAVKVHRLSGVpGQA----LAFSGQYFLTSp-------aHGhLERARRFSYAVPMSGEtIPAFAAA 166 Ruegeria pom...
Q1GM15          104 Pwp---lNTPADARLDVRIDQSYARaDGL----FELSGQYAVSSp-------dGRvREFVKRFHIETPVTESgPAAAARA 169 Ruegeria sp....
2IQI_F          162 FEQAL-TQVTTEL 173 Xanthomonas campestris pv. campestris
Q87N56          177 LSAGL-NQLTDDM 188 Vibrio parahaemolyticus
Q9KR87          174 LSAGV-DQLSTQI 185 Vibrio cholerae
Q3J7M0          176 LSKGL-ARVTDSI 187 Nitrosococcus oceani ATCC 19707
Q3IC12          183 LEKTW-QEINLAV 194 Pseudoalteromonas haloplanktis TAC125
Q1QVZ8          196 LGGAW-DTLGERL 207 Chromohalobacter salexigens DSM 3043
jgi:Mmwyl1_2931 176 LSASWfDQVIGPM 188 Marinomonas sp. MWYL1
Q15V64          181 LAEQL-SQLSSQI 192 Pseudoalteromonas atlantica T6c
Q5LU10          167 QTEAL-RLLVNDI 178 Ruegeria pomeroyi
Q1GM15          170 LSAAL-AELSRQV 181 Ruegeria sp. TM1040
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap