2G0C


Conserved Protein Domain Family
DbpA

?
pfam03880: DbpA 
Click on image for an interactive view with Cn3D
DbpA RNA binding domain
This RNA binding domain is found at the C-terminus of a number of DEAD helicase proteins. It is sufficient to confer specificity for hairpin 92 of 23S rRNA, which is part of the ribosomal A-site. However, several members of this family lack specificity for 23S rRNA. These can proteins can generally be distinguished by a basic region that extends beyond this domain [Karl Kossen, unpublished data].
Statistics
?
PSSM-Id: 397799
Aligned: 547 rows
Threshold Bit Score: 50.444
Threshold Setting Gi: 502945902
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2G0C_A         3 LYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNK 73  Bacillus subtilis
CDF79674     462 FFINVGSRDGFDWMKLKDFLKEVLELGRDDVFKVDVKESFSFFNTEKELKEKVLAFFTDYKHDGRFVNVEE 532 Formosa agariphila KMM 3901
WP_013752074 455 YFINVGSKDDFDWMKLKDFLKEELGLGQDGVYRVDCKDAFSFFNTDTEHKDKILSHFENFELDGRRVSVEE 525 unclassified Dokdonia
WP_015025631 459 FFINIGEKDGFDWMSMKDFLKDQLELDRDGVAKVDVKNTFSFFNVATDDVEKVEGVFESFMLKGRHVNVEI 529 Psychroflexus torquis
EAP86121     438 YFINVGGKDGFDWMSLKDFLKEQLDLDRDGVYKVDVKNTFSFFNTDADKLDKVMEVFADMTHEGRSVNVEV 508 Croceibacter atlanticus ...
WP_014387875 456 YFINIGARDGFEWMELKDFLRDTLEVGRDDIFKVDVKEGFSFFNTDAELADKVMSVLNNIQHNGRKINVEI 526 Flavobacterium indicum
WP_002991701 460 FFLNLGAKDGFDWMSLKDYLRDTLELGRDDLFKVDVKEGFSFFNTDAEHADKIMTILNNETYQDRRVNVEI 530 Myroides odoratus
CAL43884     468 YFVNIGSRDDFDWMQLKDFLKETLDLGRDDVFKVDVKEGFSFFNTDAEHTDKVMQVLNGFDLNGRRINVEI 538 Flavobacterium psychroph...
AEW86193     458 YFINIGARDGFEWMELKDFLKEKLELGRDDVFKVDVKEGFSFFNTDAEHVDLVMNTLNGITLEGRRINVEI 528 Flavobacterium columnare...
WP_015492150 421 IQIGIGKGDGFNRTQIADFIRKRANIDDDAVGKVGLKDSVSFVEVSEDVSDYVIQQLDGCRVGNKTVNVTI 491 Thermoplasmatales archae...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap