Conserved Protein Domain Family
HAP

?
pfam03866: HAP 
Hydrophobic abundant protein (HAP)
Expression of HAP is thought to be developmentally regulated and possibly involved in spherule cell wall formation.
Statistics
?
PSSM-Id: 146478
View PSSM: pfam03866
Aligned: 2 rows
Threshold Bit Score: 144.681
Threshold Setting Gi: 122222
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P14163   1 MMKYVFVALCLFAVVaLATEVEQKESNTRvaRLNVGG---LVGCVVALVANIVGGLLRVIIGLVVTLSGVLQIVVGTVLG 77  Physarum polycephalum
P12671   1 MMKYIFIALCFTAIV-LASESDVAKASEK--GLTVRGgdmLLDCIVAVLAQIVSGLLRVIIGLVITLSGVLEIVIGVVVL 77  Physarum polycephalum
P14163  78 LVATVASLALDVVGSTVGGILNSLLGLGAILSLVEEVLHVLLSQaLLTGLVNAIFALPLSLLVALSTLTDALASAACDCG 157 Physarum polycephalum
P12671  78 LVDVLAALALDLVKGSVTGICSDFLDFDYVTEYIEESLRSSSAQ-LLAGLVQALLALPLAVLVALVALTESIARSSCSIG 156 Physarum polycephalum
P14163 158 ASATGAG 164 Physarum polycephalum
P12671 157 LSECGLL 163 Physarum polycephalum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap