Conserved Protein Domain Family
SUN

?
pfam03856: SUN 
Beta-glucosidase (SUN family)
Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.
Statistics
?
PSSM-Id: 397780
Aligned: 170 rows
Threshold Bit Score: 294.053
Threshold Setting Gi: 549050871
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003842310 1158 NNKIPCNEFPY--GYGALPIAHEGLGGWSGIQDpqysgsdgfddittiVKGScseGSCCTAGRFCSYGCPNPYLKLSFPK 1235 Leptosphaeria...
ESW96062      151 DGTISCSSFPS--GQGVIALDWLGFGGWSGIYHp--------------SDTSt--GGSCTEGSYCSYACQPGMSKTQWPS 212  Ogataea parap...
XP_002492149  174 DGTIKCSEFPS--GNGVVALDHLGFGGWSGLYHp--------------SDTSt--GGICEPDTYCSYACQSGMSKTQWPS 235  Komagataella ...
Q6C3M7        158 DGTIDCGDFPS--GQGVIALNQLGFGGWSGIYHp--------------GSTAt--GGNCAEGAYCSYACQSGMSKTQWPD 219  Yarrowia lipo...
Q6BKL4        150 DGTISCSDFPS--GQGVVSLDHLGFGGWSGVEN---------------SDGSt--GGNCKEGAYCSYACQSGMSKTQWPS 210  Debaryomyces ...
XP_002616690  188 DGVLSCDEFPS--GQGVIALDHMGFGGWSGIYN---------------SDTSt--GGSCKEGSYCSYACQSGMSKTQWPS 248  Clavispora lu...
EER34126      161 DGVLSCDEFPV--GQGVIALDHLGFGGWSGIYN---------------SDTSt--GGSCKEGSYCSYACQSGMSKTQWPE 221  Candida tropi...
XP_011276073  164 DDTIDCTDFDSlvGQGVIALDNLDFGGFSGIYHp--------------SDTSt--GGSCKEGAYCSYACQPGMSKTQWPS 227  Wickerhamomyc...
XP_003646971  196 DGVVPCKQFPE--GEGVVSLDWLPFGGWSGIEH---------------PDTSt--GGKCTEGAYCSYACQAGMSKTQWPS 256  Eremothecium ...
Q755Z5        180 DGVVPCSEFPE--GQGVVKLNWLDFGGWSGIEN---------------HDTSt--GGKCKEGSHCSYACQSGMSKTQWPS 240  Eremothecium ...
XP_003842310 1236 KQGRTGQSVGGLFCnNNGYLEMADGSlGKTLCGQSSSSMTvrVQNNLSKSVSICRTDYPGTESMTFPLTLGPGQS-GFLA 1314 Leptosphaeria...
ESW96062      213 DQPSDGKSVGGLYC-KGGKLYRSNQD-SDYLCEWGENSAR--VVSKLDKSVAICRTDYPGTENMVIPTVVEAGGE-NILT 287  Ogataea parap...
XP_002492149  236 EQPDNGVSVGGLYCdSDGYLYRSKKD-TDYLCEWGIDVAY--VVSEIGKTAAICRTDYPGTENMVIPTVVSPGGE-LPLT 311  Komagataella ...
Q6C3M7        220 EQPANGVSVGGLLC-KGGKLYRSNQQ-SDYLCEWGTQSAI--VTSSLDKEVAICRTDYPGTENMVIPTVVEAGSSgVPLA 295  Yarrowia lipo...
Q6BKL4        211 NQPLNGVSIGGLLC-KGGKLYRSNKD-QNTLCAWDENKAS--VVNNLSKTVAICRTDYPGTENMVIPTVVDGGSS-SPIS 285  Debaryomyces ...
XP_002616690  249 NQPSNGVSVGGLQC-KNGKLYRSNPN-SKYLCEWGVDKAV--VVSKLSQDVAICRTDYPGTENMDIPTVASAGQT-TVLT 323  Clavispora lu...
EER34126      222 DQPSNGVSVGGLLC-KNGKLYKTNSR-SNYLCEWGVNKAN--VVSKLSKSVAICRTDYPGTENMVIPTVVDGGSS-SVIT 296  Candida tropi...
XP_011276073  228 SQPGNGVSVGGLVC-KNGKLRRSNTD-QKYLCEWGVDAAY--VKNELSKDVAICRTDYPGTENMVIPTYVQGGKT-LPLT 302  Wickerhamomyc...
XP_003646971  257 EQPEDGRSVGGLLC-KNGYLYRSNKN-TDYLCEWGVDKAD--VINKLDDVVSICKTDYPGCENMVVPTVVEPGKS-LPLT 331  Eremothecium ...
Q755Z5        241 EQPEDGRSIGGLLC-KNGFLHRTNKN-TDYLCEWGVDKAE--VVNKLDKVVSICRTDYPGTENMVIPTIVNPGKT-MPLT 315  Eremothecium ...
XP_003842310 1315 SPDQGKYYFWQGKATSAQYYVNKQGVSESDACTWGKPMGGVGNWSPTILGTSWDDVKAnegFTSLFQNtESPNERLDYDI 1394 Leptosphaeria...
ESW96062      288 VVDQDTYYQWQGKKTSAQYYVNNAGVSYQDGCIWSEAGTTVGNWAPLNFGAGYTNGIS---YLSLIPN-PNNREAANFNV 363  Ogataea parap...
XP_002492149  312 TVDQSSYYTWRGMKTSAQYYVNDAGVDWTTGCTWGDYGTDYGNWAPLNFGAGYDNGIS---YLSLIPN-PNNKDSLNYNV 387  Komagataella ...
Q6C3M7        296 VVNQDAYYTWMGKPTSAQYYVNNAGVSYQDGCLWGTSSGDVGNWAPLNFGAGAAGGIS---YLSIIPN-PNNRNSANFNV 371  Yarrowia lipo...
Q6BKL4        286 VVDQSTYYKWKGGSTSAQYYVNNAGVDWTDGCVWGTSGSGIGNWAPLNFGAGYDNGIA---YLSLIPN-PNNKDSLNFKV 361  Debaryomyces ...
XP_002616690  324 TVDQDSYFQWQGKKTSAQYYVNNAGVSWEDGCTWGSAGSGIGNWAPLNFGAGYTGGIG---YLSLIPN-PNNYDAANFNV 399  Clavispora lu...
EER34126      297 VVDQDTYYTWRGGATSAQYYVNNAGVAWKDGCLWGTAGSGVGNWAPLNFGAGYADGVA---YLSLIPN-PNNYDSLNFNV 372  Candida tropi...
XP_011276073  303 VVDQSTYYQWGGKGTSAQYYVNDAGVSYEKGCVWGSEGSGIGNWAPLNFGAGAVNGIS---YLSLIPN-PNNNNALNFNV 378  Wickerhamomyc...
XP_003646971  332 VVNEDTYYKWRGLKTSAQFYVNDAGVPVEEGCVWGTEGSGIGNWSPLNFGAGYIDGIA---YLSLIPN-PNNRKPLNFKV 407  Eremothecium ...
Q755Z5        316 VVDEDTYYKWRGLKTSAQYYVNDAGVSMEDGCIWSDEGSTVGNWAPMNFGAGYVDGIA---YLSLIPN-PNNRQPLNFNI 391  Eremothecium ...
XP_003842310 1395 TF----TGDGVVSPCAYKraSGQYCqGsKCsddiKGGCT 1429 Leptosphaeria maculans JN3
ESW96062      364 KIvaydDDSVVSGECYYE--NGSYN-G-DG----SDGCT 394  Ogataea parapolymorpha DL-1
XP_002492149  388 KIvaydDSSVVIGECKYE--NGSYN-G-NG----SDGCT 418  Komagataella phaffii GS115
Q6C3M7        372 EIia-tNGATVNGKCVYE--NGKYN-G-GD----SNGCT 401  Yarrowia lipolytica
Q6BKL4        362 KIva-dGDSTVSGDCTYE--NGKYN-G-DG----TDGCT 391  Debaryomyces hansenii
XP_002616690  400 KIts-yNGGTVNGECVYE--NGSYN-G-NG----SDGCT 429  Clavispora lusitaniae ATCC 42720
EER34126      373 KIva-qDGASVSGSCVYK--DGKYN-G-NG----SDGCT 402  Candida tropicalis MYA-3404
XP_011276073  379 KIvaadDDSVVSGDCKYE--NGKYL-N--G----QDGCT 408  Wickerhamomyces ciferrii
XP_003646971  408 KIvaadAHSVVSGECYYE--NGLYN-G-YS----KDGCT 438  Eremothecium cymbalariae DBVPG#7215
Q755Z5        392 KIvpadKNSVISGDCWYE--NGRYN-G-HG----TDGCT 422  Eremothecium gossypii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap