Conserved Protein Domain Family
SulA

?
pfam03846: SulA 
Cell division inhibitor SulA
Statistics
?
PSSM-Id: 397775
Aligned: 9 rows
Threshold Bit Score: 148.364
Threshold Setting Gi: 502790302
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002439604  12 TRPAAHPVAGETHRARNACQGLVSEVVYNEgQPGLTQLlLLPLLQQLGQQSRWQLWLTPQQKLSRHWVQDVGLPLSKVMQ 91  Shimwellia blattae
WP_013025278   6 TSNVCSAHRYASSSVPATHKGWITELRYSE-QPGMMQMlLLPLLQQLSQQSRWQLWLTPAHKLSRVWMQEAGLPLEKSMH 84  Pantoea
P0AFZ5        11 SSFSSAASKIARVSTENTTAGLISEVVYREdQPMMTQLlLLPLLQQLGQQSRWQLWLTPQQKLSREWVQASGLPLTKVMQ 90  Escherichia col...
A6T752        11 AQASAPAGHYAHRSGEQNTNGLISEIVYREdQPMMTQLlLLPLLQQLGQQSRWQLWLTPQQKLSREWVQSAGLPLSKVMQ 90  Klebsiella pneu...
Q6D6D3        14 SSFSANQHAAEPSVAT---GGIISEIVYNAdQPIVTHL-LLPLLQQLGTQSRWLLWLSPQQRLSRPWVQQSGLPLDKMVQ 89  Pectobacterium ...
WP_013318905  15 SHLGHNAMPKTAS------SGFISEIVYGDdHPMLTPL-LLPLLQQLGSQSRWLLWLSPQQKLSRLWLQQAGLPLEKMIE 87  Dickeya dadantii
Q7CHL5        12 NYHSLTTNDSPTRVDAPTDSGLISEFVYSEnQPVVTQL-LLPLLQQLSKQSRWLLWLTPQQKLSRSWLKQSGLPINKVVQ 90  Yersinia pestis
WP_015696693  12 SQLALPVTPSQVNTSASLNNGLITEFVYSAsQPAFAQL-LLPLLQHLGMQSRWLLWLTPQQKLSRHWLSQSGLPVDKMVQ 90  Rahnella aquatilis
AHG18570      12 SHTSLATNEAIETSRSAKGSGLISELVYNEhQPAIIQL-LVPLLQQLGMQSRWLLWLSPHQKLNKQWLLQAQLPVNKVIQ 90  Chania multitud...
WP_002439604  92 VSQMGPSTMVDAMEKALRTGNYSVVVGWLP 121 Shimwellia blattae
WP_013025278  85 IADAERYNAVEAMIKALRTGNYSVVLAWIP 114 Pantoea
P0AFZ5        91 ISQLSPCHTVESMVRALRTGNYSVVIGWLa 120 Escherichia coli K-12
A6T752        91 ISQLSPSHTIDSMIRALRTGNYSVVICWLa 120 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Q6D6D3        90 LHHINPLFTVDAMERALLTGNYSAVLCWLP 119 Pectobacterium atrosepticum SCRI1043
WP_013318905  88 LHRINPVSTVDAMEKALLTGNYSAVLCWLP 117 Dickeya dadantii
Q7CHL5        91 LRQINPLSTVEAMEKALLTGNYSVVLGWLP 120 Yersinia pestis
WP_015696693  91 VNQITAMSTVDAMEKALQTGNYSVVLGWLP 120 Rahnella aquatilis
AHG18570      91 LSQINPINSVEAMEKALLTGNYSAVLGWLP 120 Chania multitudinisentens RB-25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap