Conserved Protein Domain Family
Silic_transp

?
pfam03842: Silic_transp 
Silicon transporter
Statistics
?
PSSM-Id: 146463
View PSSM: pfam03842
Aligned: 4 rows
Threshold Bit Score: 864.553
Threshold Setting Gi: 122235983
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0QVN6   2 QHSTWNYIQMAYSMGLVIFSVIIVTALMFEKDTKIANDVHPAAALVIMWAGILWMSMVEGGQCSMVGLPP-VNRDLYKES 80  marine diatom
Q39510   1 MVSVIDGIKQFYSMALVIFSVVIVTALMFTDNTKLAKDAHPVAALVIMWLGILWMSMVEGGQCSMVGLPP-IDRDLYKES 79  Cylindrotheca fusiformis
Q0QVM6  61 VMTPITAVKYTYSLALLAFSIILIVSVIFNQGTKLST-VNPWLALCVMVGTIVWLGMMEGQQGALVGLTGvVDHLVYKES 139 Thalassiosira pseudonana
Q0QVM7  27 KLTPFNVLRYIGSIGLLIFSIIIVAALMFTGNTRVAKDANPWVALIVCILAIVWLSMIEGQQASLVGLPP-VDPTLYKDS 105 Thalassiosira pseudonana
Q0QVN6  81 HPITHQICSLGHKGDNLDRYLMGRQFMVIFINFTINLCGAPLEDA---EVLGLPSVIQSIFLGSGIAMILTVVTIGQLTA 157 marine diatom
Q39510  80 HPITYKICSLGHKGNNLDRYLMGRQFMVIFINFTINLCGAPLEGA---EVLGLPEILTDIFLGSGIAMVLTVVTIGQLTA 156 Cylindrotheca fusiformis
Q0QVM6 140 HSLAFRNTQLAYRGDNLDRYVTGRQFMVLMCVFVINLCGSPL-PGmseSSLNLPQIIEEIFLKTGIAMILMTAMISQLPP 218 Thalassiosira pseudonana
Q0QVM7 106 HPLTYKNAALAFKGDNLDRYLMGRQFMVLLVVFVINQCSSPLDPKv--DVLGLPDGVKFIFLDIGLAMIIFTCILGQLTT 183 Thalassiosira pseudonana
Q0QVN6 158 QVNASHCMLDYVNTHFMTFTLYVALAIEKTGVKHTSYLIQYFFYWLAGKPVVTNEPPRSAPQAIFFWGRCLFSVGVLFFA 237 marine diatom
Q39510 157 QVNASHCMLDYINTHFMTFTLYVTLVIEATGVMHSCYLIRDMFYHAAGKPVETNEPPRSAVQNLFHWGRVVFSLGVLCFA 236 Cylindrotheca fusiformis
Q0QVM6 219 QVNASHCMIDFINNYFALFTLYTALIIEFSGVMHASYLIQNIISLISGKPVKTREEPRTRLQASFFWLRVLMSLSTLCFS 298 Thalassiosira pseudonana
Q0QVM7 184 QVNASYAMIDFINNYFALFTLYTTMVVEFSGIMHASYLIQNILAAVSGKPISTNEEPKTGMTFAFFWGRVLMSLAILGFC 263 Thalassiosira pseudonana
Q0QVN6 238 LAVTLKALFDGNTTM---WSFIPNTVAVILFFLLMSVVGLLEGMQIAFFAVAKLRKEERGEHPMAMRTCELLFRGEGKNL 314 marine diatom
Q39510 237 LAVTIEALFNGKTTM---WEFIPNGVAIVLFILLMSVVGLLEGMQIAFFAVAKIPKAERGDHPFARKTCELLFKGKGRNL 313 Cylindrotheca fusiformis
Q0QVM6 299 MAVTVVALFQGKTTM---WQGVPEWVSLVLFFVLLTIVGMLEGMQIAFLATSKMRREQRGTSFFGKKTVEVISKKNGQNL 375 Thalassiosira pseudonana
Q0QVM7 264 LAVTLSALLNGQTSVavkYPSISPGLAVFLLFFFMSIVGMLEGMQIAFFAVAKLPASERGTSFFGKKTCELLFRGNGENL 343 Thalassiosira pseudonana
Q0QVN6 315 PGFMVGRQMTVTLCFFVIARVTTLDIEVGVDENVFGVSDPIQEFFNMGFLGAIITAILGSIAWQLVASAFPLEFLSNPMV 394 marine diatom
Q39510 314 PGFMVGRQMTVTLCFFIIARVTTLDIEVGVDDNIFGVSDGIQEFFNLGFLGAIITTILASIAWQLVASAFPIAFLSNPIV 393 Cylindrotheca fusiformis
Q0QVM6 376 PAFFIGRQLMVVGCFFILARVTTPDVEVGTGNNIFGVSDGAQAFLNTGLHAALLMTILASNTWKLAASTFPVAFVNLPFT 455 Thalassiosira pseudonana
Q0QVM7 344 PGFMIGRQLTVVCSFFLVGSFTSLTIEPGMGENIFGVSDGAQAFLNYGFQGAVITTILASITWQLAASAFPIAFLNNPAT 423 Thalassiosira pseudonana
Q0QVN6 395 YIFLNLALALEATGVVSGAWFLGIIHKNVAGFQEDEVYIGTPEE-RAAMDKADLASEKGdsvAEAHMGTNMlnlppgskg 473 marine diatom
Q39510 394 YIVLRIVLLIEATGICAGAWFLGMIHKKVAGFQLDEVYVGTAEE-RAAGMKPDHSIHAG---REFTMGTNVlndrknwee 469 Cylindrotheca fusiformis
Q0QVM6 456 YILLWCGLILEATGICSGAWVLARILKRVTKLKYDEEYVGTPERpTLSQDYLDAQMP----------------------- 512 Thalassiosira pseudonana
Q0QVM7 424 FILLVIALFLERIGLCAGAWVLASVQKKIMKFEYDEVYVGTPEE-RIENDHADKEFDSD---AGHLYGGGF--------- 490 Thalassiosira pseudonana
Q0QVN6 474 ipaewrsqkfnysKSYSEQRADILSnikdlreqiGMAGSKEEREAFEGALAMETQALLKVNKEQq-EAEDLVLVEE 548 marine diatom
Q39510 470 -----tianlsakETFSVRRERMLKnirelramaEEASSPEEKATFETAPTMETKALNKLNEEQekEATLQKDSSD 540 Cylindrotheca fusiformis
Q0QVM6 513 -------------ESLVGQSQDVLD---------EKPGEDREGAKPPESKVPSTDALDEQAQSQ--GELDVESGLA 564 Thalassiosira pseudonana
Q0QVM7 491 -------------TGHVCGSHDALD-----------------------GPMPHSKDALEAKRSK--DALEAVDAQA 528 Thalassiosira pseudonana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap