3P3V,3LFJ


Conserved Protein Domain Family
PTSIIB_sorb

?
pfam03830: PTSIIB_sorb 
Click on image for an interactive view with Cn3D
PTS system sorbose subfamily IIB component
Statistics
?
PSSM-Id: 397763
Aligned: 293 rows
Threshold Bit Score: 116.369
Threshold Setting Gi: 152026604
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3P3V_B         7 IIXTRVDERLIHGQ-GQLWVKFLNCNTVIVANDAVSEDKIQQSLXKTVIPSSIAIRFFSIQKVIDIIHKasPA--QSIFI 83  Streptococcus p...
WP_012414308   3 IVFARVDDRLIHGQiVQGWLPRMEVDEFVVIINEA--DNLVKSLLRISLPSNYGLQILNNEDAVKYLKEt----dKKIFL 76  Elusimicrobium ...
WP_004800701   2 ITLARVDERLIHGQvAYAWTMVYPSDAIIVVDQEAEKDALQRSLLEMACPRTMKCFIANESKSVEILKKyp---kKKFFL 78  Absiella dolichum
KGJ54609       3 ITTFRIDDRLIHGQvVTAWIAHSDAKQILVADDAAAKDTLQQSLLKMATPKKVDLKIMSLEDAKQLIQN--DEsdTKTLL 80  [Clostridium] i...
WP_014809009   3 IVLVRVDERLIHGQvLEGWVPSTRAEELFIANDALADDLIQQEILSSAVPFSVKVVIDSVDRIASLLMRe-NErdVRRMI 81  Desulfomonile t...
Q3A383         3 VVLARVDNRLIHGQvLEAWIPSTKANCLVVANNKIADEGLHKRLMAAAVPRGIQVVIESVEDSARFVSSp-DNdaLRVLV 81  Pelobacter carb...
Q2LSZ2        28 IVLVRVDDRLIHGQiLEAWVPFLKASSIIIANDEVASDFFRETVMRMAVPSETEVIVRSIDEFSGNYPYs-QTrgKRTLV 106 Syntrophus acid...
CDI40824       4 ITMVRVDERLVHGQiIIKWLQAKNANKIIIVDNELCKDPIMGNFLSMTVPQNVNLEIYDIYEAVETLNA--SEsnDKAII 81  Tepidanaerobact...
Q18D23         4 VKYCRCDDRLIHGQvIYKWVKHLGVKKIVVVDDETTNDVIAKGLIKMAAPKNIDLSILTVSESRRYFYN--NQadDNVFV 81  Clostridioides ...
WP_006568731   1 mKYFRVDERLIHGQvLLKWLKKTGCERLFIVDNQVAADPVIQSVLKMSVPGNVKAEFLTVIEGRTKIREd----tEDIFI 76  Anaerostipes
3P3V_B        84 VVKDLQDAKLLVEGGVPITEINIGNIHKTDDKVAItQFISLGETDKSAIRCLAHDhHVVFNTKTTPAG 151 Streptococcus pyogenes sero...
WP_012414308  77 LFSSLEDVDVVIRKGLGIKNLNVGGLHYREGRNKVlTDVYLDEKEKQMLKNFMII-GIKLDGRSVPKE 143 Elusimicrobium minutum
WP_004800701  79 VAKHPQSFLTIMKQGIEMKNINIGGIYFKEGRKQItNTVFLDQKSMDILKELHER-GVYLDGRTTPSD 145 Absiella dolichum
KGJ54609      81 LVRGPKQALYLIDSCSDVKSINVGNINMKKGKRKIlGNCWLNDEEEKDIRLLAEK--VEVEVRAVPNE 146 [Clostridium] innocuum
WP_014809009  82 LVDNPLDALRLKKLGVNFDRLNLGNLTANSAVASLsRSVILGNDSLRALLNIVEE-GVRVHIQSVPFE 148 Desulfomonile tiedjei
Q3A383        82 LFASPDDALHAYRSGLHFPQLNLGNLHRPQGLHQLgCTVTLDRDDVENLEKLESE-GVEIVLQCIPSD 148 Pelobacter carbinolicus DSM...
Q2LSZ2       107 LFSCISDAVRAYESGFHFHHLNIGNVYSEHCAMTClPSILLGTWDIDHLKVLMKN-DVTVELRRIPRE 173 Syntrophus aciditrophicus SB
CDI40824      82 LLKNLYLVKFMHQKGVKIKEINIGRIPSGPGKKKIhQNVFLSDEDIDAIEYFREK-AVPIIVQMVPDS 148 Tepidanaerobacter acetatoxy...
Q18D23        82 LIKNLDTANRMIEEGINIKKLIVGRIPTGIGKKKIsQNVYINKKEFLLIDEFIKK-NINVSIQMVPDE 148 Clostridioides difficile 630
WP_006568731  77 LIKELETVCRLADAGILTESVNIGRLPYMRGKKKIcDNVFIGEKEGEEMMRLLDQ-GTKIFVQMVPDS 143 Anaerostipes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap