Conserved Protein Domain Family
MadL

?
pfam03817: MadL 
Malonate transporter MadL subunit
Statistics
?
PSSM-Id: 397751
Aligned: 29 rows
Threshold Bit Score: 118.436
Threshold Setting Gi: 81739695
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Ilyop_1636   1 MEIYGLAFVGLCMFLGSTIGVTLGKILGISGNVGGVGFAMLIMVIATNY--LEKSGNgFSEKTQKGILLLSSLYIPVVVA 78  Ilyobacter po...
BAK18043         1 MVIYGVAILAGCFLFGMFCGELIGALMGIDSNVGGVGIAMLLLIVVVDK--LQKNGK-ISLPAQSGLAFWNAMYIPIVIA 77  Solibacillus ...
WP_013069347     1 MLIYGVSLMSGCLIAGVIIGKLIGHMVGIDADVGGVGIAMLLLVVISRW--FIDRER-MSELAQDGIKFWSAMYIPIVVA 77  Rhodobacter c...
Q2RUR5           1 MVIYGLFLMGLCMLIGNFVGNLFGAMLGISANIGGVGIAMVLLVVISQR--LMDKKK-LSEAAQAGIGFWSAMYIPIVVA 77  Rhodospirillu...
IGS:BMQ_0715     1 MIIFGVALLSICMLIGVIVGDALGGLMGVEANVGGVGVSMLLLVLAVDY--LKKKNK-LQVKSEEGIAFWGGIYIPIVVA 77  Bacillus mega...
WP_015753801     1 MKIYGVALLCGCFLAGKFLGQLLGELIGIPGDIGGVGFAMFLLMLVSLY--LRRRGW-FSDTSESGIAFWSAMYIPIIVA 77  Robiginitalea...
CCX41359         1 MVLYGSALIGACLLAGNLLGILLGQLTGLGTNIGGVGFASLFLLIVNAVrpLDK----MKEKTVAGIRFWQGMFLPIVVS 76  Clostridium s...
WP_022383174     1 MIIYGVALLAGCFMVGNLIGDMLGVVLGVKANIGGVGFAMLFLIIISTW--AQKKGL-MKEPEEQGIKFWSAMYIPIVVA 77  Dialister
jgi:Halhy_3769   1 MLIRGVALLAACFIIGQLSGETLGRILHIDANVGGVGFAMLLLILAQNW--LEQRGR-FHQEMEEGVMFWSKMYIPVIVA 77  Haliscomenoba...
jgi:Runsl_2170   1 MIIYGVALLAFCYIIGQLTGEFLGKWIGVDANVGGVGFAMLLLIFLSDW--LHKKGH-FDKPTENGILFWNQLYIPIIVA 77  Runella slith...
jgi:Ilyop_1636  79 MSSIQNVVAAINGGAVAFLAGGIATIGSLFLIPIIMKLVG 118 Ilyobacter polytropus DSM 2926
BAK18043        78 MAASQNVLGALTGGPLAIIAGIAVVLISWLCVPLLSGKKA 117 Solibacillus silvestris StLB046
WP_013069347    78 MAASQNVVAAFDAGTMAFIAGFLPVVAGFLLIRPLAALGG 117 Rhodobacter capsulatus
Q2RUR5          78 MAAQQNVVSAMNGGALAFVAGLGAVFVGFLLIKPISALGG 117 Rhodospirillum rubrum ATCC 11170
IGS:BMQ_0715    78 MSAQQNVVAALDGGGMALLAGVVVVVVGFLSIPFISRIGE 117 Bacillus megaterium QM B1551
WP_015753801    78 MAATLNVHAAFGGGWVAVLAGLGATIAGFLLVPLLSRIGR 117 Robiginitalea biformata
CCX41359        77 MSASQDIIHALDGGLVAVFAGVLPVMLGFLLVPVFCGRKK 116 Clostridium sp. CAG:1024
WP_022383174    78 MSSIQNVAAALSGGVVALAGGALAVAVGFLLIPVLAKKQP 117 Dialister
jgi:Halhy_3769  78 MSAIQNVRVALSSGLVALLAGIIPVLVCLAVMPLLSKLSP 117 Haliscomenobacter hydrossis DSM 1100
jgi:Runsl_2170  78 MSAIQNVKVAVSSGFIAILAGIVPFVICLLAIPLLAKLSN 117 Runella slithyformis DSM 19594
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap