4R1I


Conserved Protein Domain Family
ABG_transport

?
pfam03806: ABG_transport 
AbgT putative transporter family
Statistics
?
PSSM-Id: 397742
Aligned: 10 rows
Threshold Bit Score: 651.732
Threshold Setting Gi: 166215072
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4R1I_A  11 RFLRTVEWLGNMLPHPVTLFIIFIVLLLIASAVGAYFGLSVPDPRpvGAKgra-----ddgLIHVVSLLDADGLIKILTH 85 
Q9KTN8  19 RFLNFIERAGNKIPDPAILFFWALVIVWVSSALLSNVSFDLTNPR--TNE-----------ALEIKNLLTGESLAHFLAN 85  Vibrio cholerae
Q9A7U5  48 RLLDRIERVGDALPDPVFIFIGCIAILMVGSVIASALGWSAVNPVtg-------------qHLQAESLLSRENLAKLFVN 114 Caulobacter vibrioides
Q9KTM2  25 RFLDGVEYLGNLLPHPITLFAIFCVVLLVASGIAGYFELSVVDPRpeGAKgra-----adgMIHVVSLLNADGLELIVTN 99  Vibrio cholerae
Q5F721  11 RFLRTVEWLGNMLPHPVTLFIIFIVLLLIASAVGAYFGLSVPDPRpvGAKgra-----ddgLIHVVSLLDADGLIKILTH 85  Neisseria gonorrhoeae...
Q9KC22  13 KFLNFIEVTGNRLPHPITLFAILALLVIVASGILSAFNISVDDPAnpGET------------VEVMNLLSSEGIAYIFTS 80  Bacillus halodurans
P46133  14 KLYGWVERIGNKVPHPFLLFIYLIIVLMVTTAILSAFGVSAKNPt-dGTP------------VVVKNLLSVEGLHWFLPN 80  Escherichia coli K-12
Q9KEI6  19 RFLDIIEKYGNKLPDPIMLFVIMAVLILICSAIFSALGTSAVHP---GTGe----------EIEVVNLLNGEGFILILTE 85  Bacillus halodurans
Q2FVE1  14 RFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFNVSVKHP---GTHq----------TIYIKNIISHDGFTMIMND 80  Staphylococcus aureus...
Q9AA61  39 GLLGVVERLGNLLPEPVMIFVWLILGLMVLSAIGQALGWSASITYagDEApqfgelengvlTYAASSLFSEANLARLFTE 118 Caulobacter vibrioides
4R1I_A  86 TVKNFTGFAPLGTVLVSLLGVGIAEKSGLISALMRLLLTKSPRKLTTFMVVFTGILSNTASELGYVVLIPLSAVIFHSLG 165
Q9KTN8  86 MVTTFTSFAPLGIVLVAMLGVGVADSSGFITTGLKKMLNVTPAKLLTPMLILVAIISHTAADAGYVLVIPLGGIIFHAAG 165 Vibrio cholerae
Q9A7U5 115 MPETMTKFPPLGLVLVVMLGAAVAERSGLFGALLGDAIRKLPKTVLSPAIFVIGVMSHHAADAAYVVLIPMAALIYAEAG 194 Caulobacter vibrioides
Q9KTM2 100 LVKNFVGFAPLGTVLVAMLGVAIAEHSGLLSAAMRGLVMGASKRMVTFTVVFAGIISNTASELGYVVLIPLAAMLFHSLG 179 Vibrio cholerae
Q5F721  86 TVKNFTGFAPLGTVLVSLLGVGIAEKSGLISALMRLLLTKSPRKLTTFMVVFTGILSNTASELGYVVLIPLSAVIFHSLG 165 Neisseria gonorrhoeae...
Q9KC22  81 MVSNFINFPPLGVVLATMLGIGIAERSGLIGASLRGLVTAVPKSLITVTLVFAGIMSSVASDAGYVVLPPLGAMLFIALG 160 Bacillus halodurans
P46133  81 VIKNFSGFAPLGAILALVLGAGLAERVGLLPALMVKMASHVNARYASYMVLFIAFFSHISSDAALVIMPPMGALIFLAVG 160 Escherichia coli K-12
Q9KEI6  86 LVNNFTSFPPLGLVLVVMLGVGVAESTGLLSALMKTTILNAPRKLILPTIVLVAMLGNAAADAAMVVLPPIVAMIFIALG 165 Bacillus halodurans
Q2FVE1  81 TIKNFSEFPALGLVLAVMIGIGVAEKTGYFDKLMISVVNRAPRFLILPTIILIGILGSTAGDAATIILPPLAAMLFIKIG 160 Staphylococcus aureus...
Q9AA61 119 MPKTLTSFAPLGLVLVVILGAAVAERSGLFSALIRASLREAPKRILTPLVVIIGMVSHHASDAAYVVFIPLAGLLYAAVG 198 Caulobacter vibrioides
4R1I_A 166 RHPLAGLAAAFAGVSGGYSANLFLGTIDPLLAGITQQAAQIIHPDY--VVGPEANWFFMAASTFVIALIGYFVTEKIVEP 243
Q9KTN8 166 RHPLAGIAAAFAGVSGGFSANFIPSGIDPLLAGFTQTAAQVLDQSY--QVNPLANIYFTGLSSIIIVAIGWYVTDKVIEP 243 Vibrio cholerae
Q9A7U5 195 RHPLAGIAIAYAGISGAFAGNMLPGQFDVLILGITAPAAQLIDPNF--VMNPLGNWWFTLAIGTLFTPIAWWVTDRVVEP 272 Caulobacter vibrioides
Q9KTM2 180 RHPLAGLAAAFAGVSGGYSANLLIGTVDPLLSGITETAARMIDPTY--SVGPEVNWYFMAASTFVIAILGAFVTEKIVEP 257 Vibrio cholerae
Q5F721 166 RHPLAGLAAAFAGVSGGYSANLFLGTIDPLLAGITQQAAQIIHPDY--VVGPEANWFFMAASTFVIALIGYFVTEKIVEP 243 Neisseria gonorrhoeae...
Q9KC22 161 RHPLAGLAAAFAGVSAGFSANIFLSATDPMLGALTQQAAATIDPAYaeTINYAMNWYFIIASVFVLTLAGWFVTDKIVEP 240 Bacillus halodurans
P46133 161 RHPVAGLLAAIAGVGCGFTANLLIVTTDVLLSGISTEAAAAFNPQM--HVSVIDNWYFMASSVVVLTIVGGLITDKIIEP 238 Escherichia coli K-12
Q9KEI6 166 RHPLAGLAAAYASVAGGFSANLILSMLDPLVAGFTQTGAQMIDPDY--VANPAMNYYFLVASCLVLVPVAVWVTTKIVEP 243 Bacillus halodurans
Q2FVE1 161 YHPIAGLTMAYASAVGGFAANIVVGMQDALVYSFTEPATRIVSDSI--KTNVAMNWYFIAASVVVLLPTILLVTTKLIIP 238 Staphylococcus aureus...
Q9AA61 199 RHPLAGIAAGFAAVSGGFAGNLTPGQFDVVLFGFTQEAARIIDPTW--TMNPLGNWWYILAIVVVFTPIAWFLTDKVVEP 276 Caulobacter vibrioides
4R1I_A 244 QLGPYQSDLSQEEKDIRHSneITPLEYKGLIWAGVVFIALSALL-AWSIVPADGILRHPETGLVA-GSPFLKSIVVFIFL 321
Q9KTN8 244 RLAATKVDEDAESAPDLGS--FTAIESKAFRYAGWAMVAGIALL-VAAVWPENSALRSPDGEITAfTAPIMKSIVPLIFL 320 Vibrio cholerae
Q9A7U5 273 RLGPWTREDTAAAAPDLALdeIGEAQKKGLRRAGVAALVVIGLFaALTLWPG-APLVDHEAVGPKrMTPFYQSLIAAFML 351 Caulobacter vibrioides
Q9KTM2 258 KLGKYDVSEASDDLSQDKMgsLTALEKKALAYAGLAVVVVSALL-AWTIVPADGVLRG-EDGLVS-GSPFLKSIVAFIFI 334 Vibrio cholerae
Q5F721 244 QLGPYQSDLSQEEKDIRHSneITPLEYKGLIWAGVVFVALSALL-AWSIVPADGILRHPETGLVA-GSPFLKSIVVFIFL 321 Neisseria gonorrhoeae...
Q9KC22 241 RLGAFKGSLEKQSIDY-----LKPEEKKGLMWASISFIITLALM-LLLVIPEWGPLRGEGDSPII-QSPFMSSLVPVILI 313 Bacillus halodurans
P46133 239 RLGQWQGN--SDEKLQT----LTESQRFGLRIAGVVSLLFIAAI-ALMVIPQNGILRDPINHTVM-PSPFIKGIVPLIIL 310 Escherichia coli K-12
Q9KEI6 244 RLGTYTG-----EVEEITG--VTKEEKKGLRWAGISVVILAVVF-LFLTVPEQALLRDPETGSLT-VSPFMTGIVPIMMV 314 Bacillus halodurans
Q2FVE1 239 RLGKYDDSLMHDDHEETSSh-ITDKEAHALKWANISFIVTIILL-IITAIPEHSFLRNAKTGSLLdDAPLINGVGLIILV 316 Staphylococcus aureus...
Q9AA61 277 RLGPWGGQADDALKAELAKsaVTADEKRGLKFAGLAALAIVALFaALSLIPGFTPLIDETKTGPAqLTPFYGALIAGFMM 356 Caulobacter vibrioides
4R1I_A 322 LFALPGIVYGRITRSLRGEREVVNAMAESMSTLGLYLVIIFFAAQFVAFFNWTNIGQYIAVKGAVFLKEVGLAGSVLFIG 401
Q9KTN8 321 LFIIPGIVYGRVAGTFKNSNDVIKAMSATMSTMGAYIVMSFFCAQFLSAFGQSNIGTMLALYGAEGLKAMNLPGQATIVG 400 Vibrio cholerae
Q9A7U5 352 LFLTTGWAYGSATGSVKSHRDIVSMMAEGMRAMAPYLVLAFFAAHFVAMFAWSKMGPVMAVQGAETLSGLGLPKPLLLLS 431 Caulobacter vibrioides
Q9KTM2 335 FFAIPGYVYGRVVGTMKTDRDVINAMAKSMSSMGMYIVLVFFAAQFVAFFSWTKFGQVLAVLGADFLKDIGLTGPMLFFA 414 Vibrio cholerae
Q5F721 322 LFALPGIVYGRITRSLRGEREVVNAMAESMSTLGLYLVIIFFAAQFVAFFNWTNIGQYIAVKGAVFLKEVGLGGSVLFIG 401 Neisseria gonorrhoeae...
Q9KC22 314 LFLVPGLVYGAITKSIRNDKDVASQMSDTMASMGMFVVLAFTAGQFVAYFNETNMGLILGVYGATFLDNIQLTGIPLILA 393 Bacillus halodurans
P46133 311 FFFVVSLAYGIATRTIRRQADLPHLMIEPMKEMAGFIVMVFPLAQFVAMFNWSNMGKFIAVGLTDILESSGLSGIPAFVG 390 Escherichia coli K-12
Q9KEI6 315 FFLVPALVYGFVAKVFTSSKDVADHLAKSMSNMGTYIVIAFVAAQMIAFFNWSQLGPIVAIKGANFLQTIGFTGLPLLLG 394 Bacillus halodurans
Q2FVE1 317 VFLVPGLVYGILSKEIKNTKDLGKMFGDAVGSMGTFIVIVFFAAQLLAYLKWSNLGIIAAVKGAKLLEHQ--NGIVLILG 394 Staphylococcus aureus...
Q9AA61 357 LFLAGGVAYGVGVGTVKTEGDVVNMMADGVRSVAPYIVFAFFAAHFVAMFNWSRLGPIAAIHGAETLKAMNLPAPLLLVS 436 Caulobacter vibrioides
4R1I_A 402 FILICAFINLMIGSASAQWAVTAPIFVPMLMLAGYAPEVIQAAYRIGDSVTNIITPMMSYFGLIMATVMKYKKDAGVGTL 481
Q9KTN8 401 MILLTAMVNLLVGSASAKWALIGPILVPMLMAVGISPELSQAAYRVGDSVSNIISPLMVFFPLVVVYCQRYVKSTGIGTL 480 Vibrio cholerae
Q9A7U5 432 LLIMSSFLDLLIGSASAKWSAMAPIVVPMLMLLGVSPEMTTAAYRMGDSIFNIVTPLASNFPLVLILAQKWRPRFGVGSM 511 Caulobacter vibrioides
Q9KTM2 415 FILMCGYINLMIGSASAQWAVTAPIFVPMLMLVGYAPEVIQAAYRIGDSVTNIITPMMSYFGLILAVATRYMKNLGIGTL 494 Vibrio cholerae
Q5F721 402 FILICAFINLMIGSASAQWAVTAPIFVPMLMLAGYAPEVIQAAYRIGDSVTNIITPMMSYFGLIMATVIKYKKDAGVGTL 481 Neisseria gonorrhoeae...
Q9KC22 394 FILIAGFINLFIGSASAKWAVMAPVFVPIMMQLGYSPELTQMAYRIADSTTNIITPLMTYFAIIIAFAQKYDKKMGIGTL 473 Bacillus halodurans
P46133 391 LALLSSFLCMFIASGSAIWSILAPIFVPMFMLLGFHPAFAQILFRIADSSVLPLAPVSPFVPLFLGFLQRYKPDAKLGTY 470 Escherichia coli K-12
Q9KEI6 395 FIVIAALINLMVASASAKWAILAPVFVPMFMLLEYSPAFTQAAYRVGDSITNPITPMLPYFAIALTFAKKYDPKIGIGTF 474 Bacillus halodurans
Q2FVE1 395 IIVLSAMVNMLIGSASAKWGILGPIFVPMLILIGFHPAFTQVIYRVGDSITNPITPMMPYLPLLLTYAQKYDKRMKLGAL 474 Staphylococcus aureus...
Q9AA61 437 VLGFSSVLDLFIGSASAKWSALAPVVVPMFMLLGISPEMTTAAYRMGDSFTNLMTPLMSYFPLVLAMTRRWDPSMGVGSL 516 Caulobacter vibrioides
4R1I_A 482 ISMMLPYSAFFLIAWIALFCIWVFvLGLPVGPGAPTLY 519
Q9KTN8 481 ASMMMPYSIAMLIGWSLFLLVYWA-LGIPLGIQAPYTY 517 Vibrio cholerae
Q9A7U5 512 VALMLPYTIGFAIAGMALVLTWVG-LGLPVGPGAPSGY 548 Caulobacter vibrioides
Q9KTM2 495 IATMLPYSVVFMVGWSLLFYVWVFvLGLPVGPGAATYY 532 Vibrio cholerae
Q5F721 482 ISMMLPYSAFFLIAWIALFCIWVFvLGLPVGPGTPTFY 519 Neisseria gonorrhoeae FA 1090
Q9KC22 474 ISVMLPYSIVFTIVWTIMLMVWMF-FGIDLGPDSPIHY 510 Bacillus halodurans
P46133 471 YSLVLPYPLIFLVVWLLMLLAWYL-VGLPIGPGIYPRL 507 Escherichia coli K-12
Q9KEI6 475 MSSLLPYSIAFAVIWIILFTVWYL-LGLPLGPGEYIHL 511 Bacillus halodurans
Q2FVE1 475 LSSLMPYSIALSIVWTVFVIIWFL-LGIPVGPGGPIFv 511 Staphylococcus aureus subsp. aureus NCTC 8325
Q9AA61 517 LALMLPYALAFMVAGVAMTLAWVA-FDWPLGPAAQVHY 553 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap