Conserved Protein Domain Family
PBC

?
pfam03792: PBC 
PBC domain
The PBC domain is a member of the TALE (three-amino-acid loop extension) superclass of homeodomain proteins.
Statistics
?
PSSM-Id: 397732
Aligned: 18 rows
Threshold Bit Score: 229.199
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001606748   78 TQSLKKLLEELRKLpQDQDVTEPg--tQEKKIALNNHRLFPILRNVLCDLKKESYGKRGQrqffadeKPENKPNEQLIRL 155  jewel wasp
EDV28140       14 RPDVSELLQQIMSI-NEQSLDEA----QARKHALNSHRLKPTLYGVLYEIKEKTVLNIRTp------SEEDPPDQQLTRL 82   Trichoplax ad...
PDM63182      717 mapVSDLVQRLEML-TVLPLENNt--vEQGTYRLKNHYLYSTMFSIFVDLKERTRMVV---------HEEDEKDPQ-IRL 783  Pristionchus ...
CAP25808        4 ptNLAELLAEVTKI-TDMTLDENa--mNSLKCQIRVNPLHRAMQSVLIDNKEKVSISPRPalcpvnnQNEK-------ML 73   Caenorhabditi...
Q19503          5 SKSIMDLLSEVVKI-TDMTMDNEa--vNKLKPQIKINPFYRAVQDVLVEQKSKIDLSTKMmkdleaqENDE-------RL 74   Caenorhabditi...
EFP03695        5 KAPVQNLLDQLCKI-NEMPLDFDa--vAKLKQSIRTNPLHQSIQSVLVEKKQQLFLSPQMikeecveNEE--------RL 73   Caenorhabditi...
P41779          6 PANLSELLDAVLKI-NEQTLDDNd---SAKKQELQCHPMRQALFDVLCETKEKTVLTVRNq------VDETPEDPQLMRL 75   Caenorhabditi...
ESN94880       24 KRDISDILQQIMTI-TDQSLDEA----QARKHTLNCHRMKPALFQVLCEIKEKTVLSLRGp------QDDEPADPQLLRL 92   Helobdella ro...
XP_009012136   41 KQDLGDILQQIMAI-TDQSLDEA----QARKHTLNCHRMRNALFQVLCEIKEKTGLSFRGa------EEDNSTDPQLMRL 109  Helobdella ro...
XP_001606728   54 RKDINELLQQVMSI-QTQTIDSSpvsvNESKWALYNHPLMPALFNVLCEFKEKTGLSLRHt-----hEEDLQPDAQLMRL 127  jewel wasp
XP_001606748  156 DKMLIAEGIAEPqldDTCATLAKLEAS---------LGPHGIGNQDYRDKLKLVKVWYHGELAKYNMHCKSFKEHVRTLL 226  jewel wasp
EDV28140       83 DNMLISEGIIGP---DKGASAAAAAAAtas---asvHGESQIDHSDYHAKLNQIRQIYHSELEKYEQACNEFTTHVKNLL 156  Trichoplax ad...
PDM63182      784 DNMLAAEGVIGP---EKDLPASLNNQP--------------LDQDDYRYQLHNIRQQFEMEMSEREHHQQTFINNTRQLM 846  Pristionchus ...
CAP25808       74 DNMLTAEGIVVP---GCDPSHVADIKR----------------EPDFNRELNSVQNDLNQEIGACHKRRAEFSETVSNVI 134  Caenorhabditi...
Q19503         75 DTMLKAEGVAGP---DDSLLRIQEAAG--------------TDQYEYRQQLLKVRRELENETKAFDKHCKKWCEYVEDVL 137  Caenorhabditi...
EFP03695       74 DNMLRAEGITDN---HDNVKHEFELGG--------------DDQDEYRRELANVRKKFAESMKLCQENRANFCETVKYVL 136  Caenorhabditi...
P41779         76 DNMLVAEGVAGP---DKGGSLGSDASG--------------GDQADYRQKLHQIRVLYNEELRKYEEACNEFTQHVRSLL 138  Caenorhabditi...
ESN94880       93 DNMLIAEGVAGP---EKVGGSLASSSQsl-----agNQENAIEHSDYRAKLAQIRQIYHTELEKYEQACSEFTAHVVNLL 164  Helobdella ro...
XP_009012136  110 DNMLIAEGVAGP---EKGGGNSLSVATqaamstghdSPENTIEHSDYRAKLNQIRQVYHAEYEKYEQACSEFTTHVVNLL 186  Helobdella ro...
XP_001606728  128 DNMLIAEGVTEP---NKAGGSAAARASs--------QIDSAIEHYDYRSKLATIRQWYHQELKKCERDTSVFTDHVMTLI 196  jewel wasp
XP_001606748  227 AEQCATRPISVEEAERTIDMIHRKFEAVQIVLKQQTCESVMTLRSRCLD 275  jewel wasp
EDV28140      157 SEQSRTRPITPKEMDRMVSIIHRKFSAIQVQLKQSTCEALMILRSRYLD 205  Trichoplax adhaerens
PDM63182      847 KLQSETRPISELDLGRVESAVRKKLVYYQIQLKQETCEQIMTLKSKFCD 895  Pristionchus pacificus
CAP25808      135 RSQGEFRPITHKDIECMSNMVSHKFQKVIECAKQRSCENVTHLKRVYMD 183  Caenorhabditis briggsae
Q19503        138 QQQGEFRPITQQSTEKFMNKMSGKFNKVCFVLKQTACEEVIQLKKRYLD 186  Caenorhabditis elegans
EFP03695      137 HSHGEFRPITHSAIEKMAQIVSNKFSKVSELLKQSTCESVIQLRRRYFD 185  Caenorhabditis remanei
P41779        139 KDQSQVRPIAHKEIERMVYIIQRKFNGIQVQLKQSTCEAVMILRSRFLD 187  Caenorhabditis elegans
ESN94880      165 REQGCTRPIAPKEIDRMVSIVRKKFTAIELQLKQSTCEAVMILRSRFLD 213  Helobdella robusta
XP_009012136  187 REQSRTRPVAPKEIERMVSIIRKKFTSIELQLKQSTCEAVMVLRSKFLD 235  Helobdella robusta
XP_001606728  197 KEQGAVRPINSKEGEKTVQIIQKKLSNIQIQLKQQTCEAVMSLRSRFLD 245  jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap