Conserved Protein Domain Family
DUF320

?
pfam03777: DUF320 
Small secreted domain (DUF320)
Small domain found in a family of secreted streptomyces proteins. It occurs singly or as a pair. Many of the domains have two cysteines that may form a disulphide bridge.
Statistics
?
PSSM-Id: 397719
Aligned: 86 rows
Threshold Bit Score: 36.8405
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA488350:D1794_24395  25 YAHAG-SGASGAAVGSPGVASGNAVQVPVSVPVNVCGNSVNVVGLLNPTFGNNCVN 79  Streptomyces clavuligerus
WP_015797200             24 ASASG-AGAIGGAIGSPGLLSGNNIQIPINIPINLCGNDISVLAALTGAAGNTCVN 78  Catenulispora acidiphila
jgi:Caci_1493           450 hTAGG-AGAEGRAIGNNGLAAGNVAQLPINIPTEICGVVAAFGAYHDTAAGNSCVN 504 Catenulispora acidiphila DSM...
BGI:SBI_08195            25 ASAHG-PQAQGQAVNSPGVVAGNEAQVPVFVPVNACGNTVRAIGVMNQTFGTSCGN 79  Streptomyces bingchenggensis...
WP_003957889             24 AASASgAAAGAEAVGSPGIVSGNVVQVPVHVPVNKSGNTVNVIGVLNPAFANQAAN 79  Streptomyces clavuligerus
jgi:Caci_5233            24 MASAE-ATAGGSSVGSPGIVSGNTIQVPVHVPVNACGLTVSVIGILDQAFGNTCVN 78  Catenulispora acidiphila DSM...
EDY51901                107 aeqgggAQATGVAANSPGVGSGNVVQVPVEVPVNACGNSVDAGGVLNPAFGNECVN 162 Streptomyces clavuligerus
WP_012785710            210 ADSAG-AAASSEDFGGGGLLAGNTVEVPVDAPVNICGVVATVLGGGDHAEGEHCVN 264 Catenulispora acidiphila
WP_015793820             96 PSSGG-ASASGSSVGSPGILSGNTIQAPVRVPVNACGDTVNVVGVGNGAKGNHCAN 150 Catenulispora acidiphila
WP_015793820            154 TTGGG-ATATGSSVGSPGIISGNTVQVPVNVPVNLCGDTVNVVGVGNNADGNHCLN 208 Catenulispora acidiphila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap