2XU2,2DFA


Conserved Protein Domain Family
LamB_YcsF

?
pfam03746: LamB_YcsF 
Click on image for an interactive view with Cn3D
LamB/YcsF family
This family includes LamB. The lam locus of Aspergillus nidulans consists of two divergently transcribed genes, lamA and lamB, involved in the utilisation of lactams such as 2-pyrrolidinone. Both genes are under the control of the positive regulatory gene amdR and are subject to carbon and nitrogen metabolite repression. The exact molecular function of the proteins in this family is unknown.
Statistics
?
PSSM-Id: 397699
Aligned: 412 rows
Threshold Bit Score: 218.413
Threshold Setting Gi: 123611102
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XU2_A                           10 LLNCDMGESFGAWRMG--DDVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLSGFGRRSLACSAE 87  Pseudomonas aeruginosa PAO1...
Q1DC03                            8 LLNVDLGELPG-------EDEQLYALAHVANIACGGHAGDDASMRRALERCERHGTRVGAHPSYEDREGFGRRALDVTPE 80  Myxococcus xanthus DK 1622...
jgi:Haur_4381                     4 DLNADLGE-------GsdFDAELMSLLSSCNIACGGHAGDQASMRTALQLAQQHNLCVGAHPSYPDRAHFGRVVLELEPS 76  Herpetosiphon aurantiacus DSM 785...
jgi:Sama_0021                     5 QLNADVGE-------GypFDADIIALVDAANIACGGHAGDSNSMRATVKLAIANGCLIGAHPSFPDKANFGRQPMRMEAI 77  Shewanella amazonensis SB2B...
BAJ00008                         11 DLNADLGE-------GgaNDAALLQLITSANIACGGHSGDQSSMHTAVRLALASGVNIGAHPSFPDRKHFGRQPMIISDQ 83  Shewanella violacea DSS12...
jgi:Fbal_1197                     4 DLNCDVGELEGSA--N--LDAELMRLISSANIACGAHAGNPALMRRTIALALEHGVAIGAHPGYEDRAHFGRRPLNLPAD 79  Ferrimonas balearica DSM 9799...
dbos:1099484000100_PB2503_04707  10 DLNADVGEGMG-------DDRALIPLVSSVNIACGGHAGTPETMRRAVDLADRSGVGIGAHPAYPDREGFGRRSMDLSPT 82  Parvularcula bermudensis HTCC2503...
Q5NI64                            3 LINCDLGER----GVAhpIDDRLVDYIDIANIACGGHAGDKASVDYYVNLCKGKNVKITAHISYPDKQNFGRKVIDIDHN 78  Francisella tularensis subsp. tularensis...
WP_013042979                      4 LLNCDLGENEPTT-----RTAELLALVDAANICCGVHAGSAAKTRETIGLAKRAGVLIGVHPG--MAAAGGRGAELPDPV 76  Coraliomargarita akajimensis...
Q0C0C1                            6 CLNADIGELPGEA--GraLDHAILDVVSRCSIACGGHAGDAESMAETLRMAKARGVLAGAHPSYADREGFGRSRNNVSLP 83  Hyphomonas neptunium ATCC 15444...
2XU2_A                           88 EVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRkg-lpLMVLALADngrELELADEAD 166 Pseudomonas aeruginosa PAO1...
Q1DC03                           81 HLRAQVAAQCGRLAKLAADRHLPVAYAKPHGALYHAANATPALARAVVAGIVEALgtavtFIGPGTGA---LHDAALAAG 157 Myxococcus xanthus DK 1622...
jgi:Haur_4381                    77 QLQASLTAQITQLQRLATEQGTKVHYVKPHGALYNQAAIDSDLAQLLITTIQTIDps-laLMGLAGSS---LLEQAATAG 152 Herpetosiphon aurantiacus DSM 785...
jgi:Sama_0021                    78 ALTTSLIDQIQALKQICDEEGATMFHVKPHGALYNQAAFDKELASCLIEAIQAVDak-lvLMGLAASP---LLQWAREAG 153 Shewanella amazonensis SB2B...
BAJ00008                         84 ELLASIYQQINSLKAVCDSLGAKMFHVKPHGALYNLAAFNERLGLLLIETIKRIDps-lkLMILAASP---LVQLARQQG 159 Shewanella violacea DSS12...
jgi:Fbal_1197                    80 TLRDSLLRQLDSLAEAVAQQGGQLRHIKPHGALYNQAGADAELAARLAQWVKAFDpa-liLVGGAGGA---LLQAGRAIG 155 Ferrimonas balearica DSM 9799...
dbos:1099484000100_PB2503_04707  83 ALREALISQIEALVDVT--TREAVGHVKPHGALYNDAHKDKALAALMVDVLRMTlps-arLVGPPGGE---LEAAAMAVG 156 Parvularcula bermudensis HTCC2503...
Q5NI64                           79 VLCESFDQQFALFDSE-------IKAIKPHGVLYNQLNVDQELAKTFIQWCIKNNid-elLVSPFGV----VAEYAKDKG 146 Francisella tularensis subsp. tularensis...
WP_013042979                     77 ALSSLLREQCGFFAEAAAELDASIHHIKLHGSLYSAVEQDEELAQIYADVLRDYpd--wkVFSLANGT---FGRRAASDG 151 Coraliomargarita akajimensis...
Q0C0C1                           84 QLALSLKEQVASLLAIAAATDTQVRHIKPHGTLYNDAARDGELATLTAALCVDAGin--tLLGPPASE---LERAAQAAG 158 Hyphomonas neptunium ATCC 15444...
2XU2_A                          167 VPLLFEAFADRAYLPDGR----LAPRRLGGAVHHDPQRIIEQALAIARgEAFPDY-DGNPLRLTADSLCVHGDNPQSLAV 241 Pseudomonas aeruginosa PAO1...
Q1DC03                          158 LAYAREGFADRGTRPDGS----LIPRGQPGAVLTDHAQARANTVRL-------AT-SGS-----VDTVCVHGDTPGAVEL 220 Myxococcus xanthus DK 1622...
jgi:Haur_4381                   153 LQTIAEGFIDRAYEIDGC----LRSRSLAGAVHHEPNVALQQALALAKgMPFPSY-TKLPIRLTVQSLCLHSDTPQALAF 227 Herpetosiphon aurantiacus DSM 785...
jgi:Sama_0021                   154 LRVQAEAFADRRYEADAT----LVSRQQPGAVIHNQAEALAQVQALMs-GSLTSI-DGARLRLRADTLCLHGDNPEALQF 227 Shewanella amazonensis SB2B...
BAJ00008                        160 LDVIEEAFADRRYLHNAS----LAPRQMQGAVIENDTQALEQVELLLGnKPLPTL-DGALLRLKADSICIHGDSEHALSF 234 Shewanella violacea DSS12...
jgi:Fbal_1197                   156 LNVASEGFADRRYRDDGQ----LLSRQQPGAVLSDPDDALKQARALITgQPIVSD-THKPLRLAIDTLCLHGDSPQALNF 230 Ferrimonas balearica DSM 9799...
dbos:1099484000100_PB2503_04707 157 LVFTAEGFVDRAYAEDGS----LIPRSEEGAVLVSEADRLRQAISLGLrHEVETL-SGETIGLRVQTLCLHGDSDGAVAS 231 Parvularcula bermudensis HTCC2503...
Q5NI64                          147 IKTIKESFAERGYMLDNHnnpmLIPRGQPNAEIEDVALAVAQYNQL-KqGFVKIA--GEEIAFKSQTICIHSDSSIALEL 223 Francisella tularensis subsp. tularensis...
WP_013042979                    152 HPVVGEIFADRAYLDNGA----LMPRSQAGALIEDVELAVERFRNWLVtRQMQTGlTG-SILLDAETVCVHSDSPNALEL 226 Coraliomargarita akajimensis...
Q0C0C1                          159 LTYVTEGFADRAYEPDLS----LTPRALPGAVLEDPAAQSAQALSMALdQQVRVR-TGTFIPIRVQTICLHGDTPGAARS 233 Hyphomonas neptunium ATCC 15444...
2XU2_A                          242 LRRLRAALD 250 Pseudomonas aeruginosa PAO1
Q1DC03                          221 AREVRATLD 229 Myxococcus xanthus DK 1622
jgi:Haur_4381                   228 AQAVRTALV 236 Herpetosiphon aurantiacus DSM 785
jgi:Sama_0021                   228 ARRIRALLE 236 Shewanella amazonensis SB2B
BAJ00008                        235 AKQISARLT 243 Shewanella violacea DSS12
jgi:Fbal_1197                   231 AQIIHHWLQ 239 Ferrimonas balearica DSM 9799
dbos:1099484000100_PB2503_04707 232 ARAVRAALL 240 Parvularcula bermudensis HTCC2503
Q5NI64                          224 AQELyknkg 232 Francisella tularensis subsp. tularensis
WP_013042979                    227 LRKLQNckk 235 Coraliomargarita akajimensis
Q0C0C1                          234 AALLRAALE 242 Hyphomonas neptunium ATCC 15444
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap