5FLG,5TVA


Conserved Protein Domain Family
BioW

?
pfam03744: BioW 
Click on image for an interactive view with Cn3D
6-carboxyhexanoate--CoA ligase
This family contains the enzyme 6-carboxyhexanoate--CoA ligase EC:6.2.1.14. This enzyme is involved in the first step of biotin synthesis, where it converts pimelate into pimeloyl-CoA. The enzyme requires magnesium as a cofactor and forms a homodimer.
Statistics
?
PSSM-Id: 397697
Aligned: 35 rows
Threshold Bit Score: 269.069
Threshold Setting Gi: 406774294
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FLG_B                9 YSVRMRASMNgsh--edgGKHISGGERLIP-FHEMKHTVNALLEKGLS---HSRG-KPDFMQIQFEEV-HESIKTIQPLP 80  Bacillus...
Q6A6M4               12 WSVRMRATGTld----dePYHVSGAESLVA-PGMIEQTVAGLTQRALA---PGHTvKARQVRVSLDQLdVEPT-IIPALP 82  Cutibact...
B5YK86                2 WSVRMRASKKen----niEKHISGAEGIYD-YSQIERVLKQLFKRAFE---HSKG-KPDKVVITVERI-NEEIQTVSALP 71  Thermode...
SDU_Lin:LFML04_1509  16 FSIRMRAFSG--------EKHLSGGEDLVE-RSALRDRLLALTEQGLTssrNQEG-VLPSLNIRVEPVkNSSVLRKTLLP 85  Leptospi...
EEX77134              4 YSLKMRAEKNag-----kREHVSGAEKILS-EEELPEHLAALLSRALH---HAKG-KADFVNFKVEAIaPEAVEHLPALP 73  Selenomo...
CBL25219              7 YSIKMRASKKen----gtDVHISGAEKIVE-APDVDIFANALIERGMH---HSKG-EADALNLKINKVcKENIIYLDALS 77  [Ruminoc...
C9RPK4                4 YSLKMRASQHvgegenshEQHISGAERIVG-RDSVEAVCAAMVRRAMN---HSKG-DPDFINVKIEKVhESDIQVLKSLP 78  Fibrobac...
B8J3V1                3 YSIKMRAESG--------SRHISGAERIVE-RRDMAQAMDALTRRGME---HPNG-PAEAVTVTVRPI-TRPLMHIQALP 68  Desulfov...
WP_013242038          4 YSVRMRASLQ--------GQHISGAETLVScPTDVPRLTAQFVERAMN---HAKG-VPDAITTKIESIpESDIQRVPRLL 71  Coryneba...
Q6NGW9               10 VSIKMHASSN--------GAHISGAETLVD-ESRAYEFLSSFYQRANT---HSKG-KPEITTLTIRRIkDADIITIPALE 76  Coryneba...
5FLG_B               81 VHTNEVSCPEEGQKLARLLLEKE------------GVSRDv-iEKAYEQIPEW-----SDVRGAVLFdIHTGKRMDq-TK 141 Bacillus...
Q6A6M4               83 TELKECPDPVAARQYFVDVLSRF-------------VPHP---AEALRVLTEG-----PTMRGAAMVeAGTDRRLEa-DP 140 Cutibact...
B5YK86               72 VNTFFTNSPEEAFCLISEKLSSI------------GISDKa-lFSAFEVIKK------YPMRGATLIdSITGERLEr-DK 131 Thermode...
SDU_Lin:LFML04_1509  86 VHCLESSSHQETLSFLSGVLEAI------------GSRESidtSSLGRWLNDVlngteSGLSGASLF-FPDGERWI--PE 150 Leptospi...
EEX77134             74 VSTVEVETPAEGRRVIIDALENL------------GLKNG---EAILAKFSET-----YGMRGAMLLdADTLERLEp-DA 132 Selenomo...
CBL25219             78 VETIEVETWEKGQEEIKKYLKET------------GIDNP---QDVMQFLDET-----YAMRGAMLLdVDRLIRLEp-DK 136 [Ruminoc...
C9RPK4               79 VTRVDVETWQEGLEKAFGLITPLmalrqaqgpcdgAKKFK---EKLQDLLRET-----FPMRGAMLYdIATGNRLEp-DK 149 Fibrobac...
B8J3V1               69 VHEPHVRDQHEARQVLTEELR--------------GMALDp--SPVLDLLYSLr----KPMRGAVLLdVTGMKRLEp-DP 127 Desulfov...
WP_013242038         72 TREYQARDCHDAHGFVQQQLTTV-------------CSAEv-aQKAVDLLLTI-----RNMRGAILLdAHSARRLEp-DH 131 Coryneba...
Q6NGW9               77 VKCLPALHPSEAHRQVIEQLSNV-------------VSPTi-aQMALHTVLNA-----RNMRGAILLcAHTGQRLDpyDP 137 Coryneba...
5FLG_B              142 EKGVRVSRMDWPDANFEKWALHSHVP---AHSRIKEALALASKVSRHPAVVAELCWSDDPDYITGYVAGKKMgYQRITAM 218 Bacillus...
Q6A6M4              141 LRGVRVTKFGDLTESAPGASLA-------HKKHHHEAVLLASKVAAAPGVLAEFCISDDPHYTRGYVCVDGV-YTTVTNV 212 Cutibact...
B5YK86              132 TRGIRVSRIHMDKRKRMKLIRQIKNLs-tQPQRVIEAITIASKVASYPEVVAELCISDNPDYTIGYIASRDLgYLRITNI 210 Thermode...
SDU_Lin:LFML04_1509 151 NRGVRVTQFGMVPAIRQTLLEEAKNHpagSGRRFVDALQIASKVAGLPDFLLELCASDNPEYTTGYIALRNFgYLRLPLL 230 Leptospi...
EEX77134            133 ERGLRATYMDAERAAKGASD---------CKNHFAEAVVLATKVVHAPHIVAEICVSDDPDYVTGYVAAQSFgYRRITKL 203 Selenomo...
CBL25219            137 KRGIRATNMDQERMKGDRIGN--------EKNHYEEAIVLATKVANCPGIIGEICISDDPEYVTGYVSSKEIgYRRITKM 208 [Ruminoc...
C9RPK4              150 DRGVRATYMDALHSSEVDG----------CKNHFNEAIVLATKVANAPGMVAEFCVSDDPNYVTGYVASKELgYVRIMKM 219 Fibrobac...
B8J3V1              128 QRGVRATCMDYTGNRCE------------GKNHFREALCLASKVAHCPQIIGELCISDDPDYTTGYFASQVRgYVRIHHI 195 Desulfov...
WP_013242038        132 NRGIRASNFGDASSISAKPDNKEIGI---SKNHYHEALILSSKVMSAPGIIAEICISDDPDYTTGYVSLNGV-YTRVHTM 207 Coryneba...
Q6NGW9              138 QRGVRASTFGVTPQESAGP-----TL---NKSHFNEALVLASKVMSAPGIVAEICISDDPAYTTGYVTTENT-YIRIPHM 208 Coryneba...
5FLG_B              219 KEYGTEEGCRVFFI-DGSn--DVNTYIHDLEKQPILI 252 Bacillus subtilis
Q6A6M4              213 KADGDPNGGRVILV--DTaraDPTTITTWLENHPVLI 247 Cutibacterium acnes KPA171202
B5YK86              211 KNKGETIGGRAFFV-KTPc--DIEKLTNYLERKPVLV 244 Thermodesulfovibrio yellowstonii DSM 11347
SDU_Lin:LFML04_1509 231 KRAGNSSGGRVILLsRKLderERAHAVSYLSRTPVLF 267 Leptospirillum ferriphilum ML-04
EEX77134            204 KEAGSPDGGRIFLY-RGSr-dGVADTIRYLEKQCVLV 238 Selenomonas sputigena ATCC 35185
CBL25219            209 KRMGSEKGGRIFLF-RGTd-aEEQKAIDFLQNQHVIV 243 [Ruminococcus] torques L2-14
C9RPK4              220 KEMGDENGGRIFLF-DSRk-aSAEECIEYLQKKKVLV 254 Fibrobacter succinogenes subsp. succinogenes S85
B8J3V1              196 KQAGQQLGGRIFLF-RGQq-aEIGQCVDYLENQPVMV 230 Desulfovibrio desulfuricans ATCC 27774
WP_013242038        208 KRLGSPLGGRVFIL-DSEk-aSVATAINHIENTPVLI 242 Corynebacterium pseudotuberculosis
Q6NGW9              209 KDPYSPIGGRVFLL-DTRv-sTPEDTISYLEQKPVLI 243 Corynebacterium diphtheriae NCTC 13129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap