6OKK


Conserved Protein Domain Family
Ribosomal_S5_C

?
pfam03719: Ribosomal_S5_C 
Click on image for an interactive view with Cn3D
Ribosomal protein S5, C-terminal domain
Statistics
?
PSSM-Id: 397675
Aligned: 475 rows
Threshold Bit Score: 53.8675
Threshold Setting Gi: 156086392
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OKK_G                    171 SGKCGSVRIRLVPAPRGTQIVGAPTTKKMLNFAGIKDCFSSSCGkTKTKGNFLRAIFNALS-KTYGYL 237 Plasmodium fal...
EGF83024                  173 ehTYHKTVLQLRTASPGYGLMVNRNIHEVCRCIGITDLSGKVRG-SLNPMNVIKATFDALS-TQKNPS 238 Batrachochytri...
CCD25173                  220 dHRYHGVKLFLRNARPGFGLRVNHVIFEICECAGIKDLSGKIYK-SRNPMNIAKGFLEALTeNQKTVD 286 Naumovozyma da...
CCK72728                  224 dYKFHGSRLFVRRREAGFGVRTNHVIFEICQLAGIKDLSAKVYG-SRNEMNIAKGFLELLTtAQGSLR 290 Kazachstania n...
XP_007375626              240 eSKFHGVKMRVRSAPEGSGLRVNHIIYEICQAAGIKDLGAKVYK-SRNPMLIAQGFVKALG-QQQSIE 305 Spathaspora pa...
EDK38258                  242 EYKFHAVKLFIKSAPSGFGLRVNSNIFEVCQAAGIKDLRGKIYK-SRNSMNVVKGFVEALT-KQRTIE 307 Meyerozyma gui...
XP_001527806              248 ETKYHGVKLNFKPAPIGFGLRCNHIAFEICQAAGIKDIRGKIFE-SRNPFMVAKGFVEALT-KQKTIQ 313 Lodderomyces e...
XP_002549004              246 eHKFSASKLKFSAAPIGFGLRCNRIVFEICQAAGIKDLKGKIFK-ARNPMHVAKGFFEALT-KQKTIE 311 Candida tropic...
WGS:AACQ:CAALFM_C110470WA 251 EYKYHATKLKFSPAPVGFGLRCNKNIFEICQAAGIKDLKGKIYK-SRNPLTVANGFFKALT-QQRSLE 316 Candida albica...
XP_011273091              238 dHNYHGCKLHLRSAPKGFGLRVNHYLFEICEIAGIKDLSAKIYK-SRNGMKIAKGIVEALS-SQKTLE 303 Wickerhamomyce...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap