1V4A


Conserved Protein Domain Family
GlnE

?
pfam03710: GlnE 
Click on image for an interactive view with Cn3D
Glutamate-ammonia ligase adenylyltransferase
Conserved repeated domain found in GlnE proteins. These proteins adenylate and deadenylate glutamine synthases: ATP + {L-Glutamate:ammonia ligase (ADP-forming)} = Diphosphate + Adenylyl-{L-Glutamate:Ammonia ligase (ADP-forming)}. The family is related to the pfam01909 domain.
Statistics
?
PSSM-Id: 397667
Aligned: 15 rows
Threshold Bit Score: 247.228
Threshold Setting Gi: 57012862
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V4A_A   29 SAQAKSVLTFSDFVQDSVIAH----PEWLTELESQ--PPQADEWQHYAAWLQEALCNVSDE----AGLXRELRLFRRRIX 98   Escherichia coli
Q9HUF4   47 LEDFRRVAAASDFVAEQAVRD----SAMLLELAERgeLENPHAPGELRSQLQARLEDCADE----DELGRRLRRFRTRQQ 118  Pseudomonas aerugin...
Q9HUF4  576 LERLLTLCAASPMVAEQIARF----PILLDELLNEgrLFRPPQAAELAAELRERLMRIPEDd--lEQQMETLRHFKLAHG 649  Pseudomonas aerugin...
Q9A4S7  589 FELIVEVMAFAPRLAATMAKR----PTALDALLDPtfFGPIETPAIAPWDPEDF-----------EGAMDAARRLFRDQS 653  Caulobacter vibrioi...
Q5F608  519 lAQLAQIMSQSSWVAAYLNKY----PILLDELISAqlLDTAFDWQALAAALSDGIEACGGDt---EAQMDTLRHFQHAQV 591  Neisseria gonorrhoe...
P44419  589 LQQVIELCAQSQLISEQLAHY----PILLDELLNTeaLRHPLPFTQYPAELHQYLLRLPPDd--eEQLIDALRQFKQATL 662  Haemophilus influen...
P30870  552 LKHLISLCAASPMIASQLARY----PLLLDELLDPntLYQPTATDAYRDELRQYLLRVPEDd--eEQQLEALRQFKQAQL 625  Escherichia coli K-12
Q9KPD4  556 LVQLVRLCTASPMISEQLARY----PILLDELIDPqhLYNPIPLESYQTELRDFLARIPEEd--mEQQMEGLRQFKQISI 629  Vibrio cholerae O1 ...
Q9A4S7   70 WGSLAPVFAASPYLAGLARRDgkrlPRIL--------GGDPGETLAAILAAAEAVAAEPDF----ETARRVLRELKADLH 137  Caulobacter vibrioi...
Q79VE2  627 GQRLMRILGNSPYISELIIST----PDFMKQLGDA--ASGPKLLATAPTQVVKAIKATVSRhespDRAIQAARSLRRQEL 700  Corynebacterium glu...
1V4A_A   99 VRIAWAQTLALVTEESILQQLSYLAETLIVAARDWLYDACCREW-GTPCNAQ-GEAQ-PLLILGXGKLGGGELNFSSDID 175  Escherichia coli
Q9HUF4  119 LRIIWRDLTRRAALAETCRDLSALADACIDLACEWLHRRQCEQF-GTPIGRRsGEPQ-RMVVLGMGKLGAVELNLSSDID 196  Pseudomonas aerugin...
Q9HUF4  650 LRVAASEIAGTLPLMKVSDYLTWLAEAILVEVLELAWRQLVQRH-GRPLRADgTPCDpDFVIVGYGKVGGLEFGHGSDLD 728  Pseudomonas aerugin...
Q9A4S7  654 FRIGVRVMSGTADARDIGRAFAELADLIIGGLAPAALAEVERIGgAFPG---------QVAVVALGKAGSREMTAKSDLD 724  Caulobacter vibrioi...
Q5F608  592 FRLAVQDLAGLWTVESLSDQLSALADTVIAAALSCAWADMPKKH---------RDTP-QFAVIGYGKLGGKELGYASDLD 661  Neisseria gonorrhoe...
P44419  663 LKVAAADILGALPVMKVSDHLTYLAEAIIEVVVNLAWKQVSSRF-GVPEHLQnNEK--GFLVIGYGKLGGIELGYKSDLD 739  Haemophilus influen...
P30870  626 LRIAAADIAGTLPVMKVSDHLTWLAEAMIDAVVQQAWVQMVARY-GKPNHLNeREGR-GFAVVGYGKLGGWELGYSSDLD 703  Escherichia coli K-12
Q9KPD4  630 LRIAAADIAGVLPVMKVSDHLTYLAEAIVEAVVSQAWLQVSSKY-GEPTHLKhRDGR-GFAVVGYGKVGGWELGYNSDLD 707  Vibrio cholerae O1 ...
Q9A4S7  138 LLTAISDLGGVWDLDQVTGALTRFADAVLHAALAQAVRQEVSRGaLTHVGDGsAGPApGLFCVAMGKHGAFELNYSSDID 217  Caulobacter vibrioi...
Q79VE2  701 ARIASADLLNMLTVQEVCQSLSLVWDAVLDAALDAEIRAALND------PQKpDQPLaNISVIGMGRLGGAELGYGSDAD 774  Corynebacterium glu...
1V4A_A  176 LIFAWPEHGCTQ--GGRRELDNAQFFTRXGQRLIKVLDQPTQDGFVYRVDXRLRPFGESGPLVLSFAALEDYYQEQGRDW 253  Escherichia coli
Q9HUF4  197 LIFGYPEGGETE--GAKRSLDNQEFFTRLGQKLIKALDAITVDGFVFRVDMRLRPYGSSGPLVYSFAALEQYYQDQGRDW 274  Pseudomonas aerugin...
Q9HUF4  729 LVFIHDGDPQCEt-DGGKSIDGAQFFTRLGQKIIHFLTAQTPSGTLYEVDMRLRPSGAAGLLVSSLGAFQRYQEQEAWTW 807  Pseudomonas aerugin...
Q9A4S7  725 LMTLYVADDPRSm-SALKDWSAEVFYARLTQRLTSALSAPTGEGTLYEVDLKLRPSGTKGPVAVSFAAFEHYYEREAETW 803  Caulobacter vibrioi...
Q5F608  662 LVYLYDDPHPE----------AGDVYSRLARRLTNRLSAATGAGSLYETDLRLRPNGDAGFLAHSIAAFGKYQRENAWTW 731  Neisseria gonorrhoe...
P44419  740 LVFLYDAVE-SQttGGKKVIDSNQFYLRLAQKIVSIFSINTSAGVLYEADMRLRPSGDAGLIGCSLSAFSHYQLNDAWTW 818  Haemophilus influen...
P30870  704 LIFLHDCPMDAMt-DGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVTSAEAFADYQKNEAWTW 782  Escherichia coli K-12
Q9KPD4  708 IVFMHDCPVEVNt-DGEKSIDGRQFYLRLAQRIIHIFSTRTASGILYEVDTRLRPSGASGLLVSPTDAFDEYQRQEAWTW 786  Vibrio cholerae O1 ...
Q9A4S7  218 FSIFYAPEKLP----VAEGHEPQAVAVRIANHLGRILQERTGDGYVFRIDLRLRPDPSSTPPAMPVDAAMDYYESVGQNW 293  Caulobacter vibrioi...
Q79VE2  775 VMFVCEPVAGV------EEHEAVTWSIAICDSMRSRLAQPSGDPPL-EVDLGLRPEGRSGAIVRTVDSYVKYYEKWGETW 847  Corynebacterium glu...
1V4A_A  254 ERYAXVKARIXG-DSEGVYANELR 276  Escherichia coli
Q9HUF4  275 ERYAMIKARVVG-GDQQAGEQLLG 297  Pseudomonas aeruginosa PAO1
Q9HUF4  808 EHQALVRARVLA-GCRRVQASFEA 830  Pseudomonas aeruginosa PAO1
Q9A4S7  804 ELLALTRARVVWaSSPDFKARAEG 827  Caulobacter vibrioides CB15
Q5F608  732 EHQSLTRARFIC-GTPEIQTAFDR 754  Neisseria gonorrhoeae FA 1090
P44419  819 EKQALVRARPVF-GESSLKAKFEH 841  Haemophilus influenzae Rd KW20
P30870  783 EHQALVRARVVY-GDPQLTAHFDA 805  Escherichia coli K-12
Q9KPD4  787 EHQALVRARMIY-GDAPLQQAFAN 809  Vibrio cholerae O1 biovar El Tor str. N16961
Q9A4S7  294 ERAAHIKARIAA-GDAAEGAAFLE 316  Caulobacter vibrioides CB15
Q79VE2  848 EIQALLRAAWVA-GDRELGIKFLE 870  Corynebacterium glutamicum ATCC 13032
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap