Conserved Protein Domain Family

pfam03709: OKR_DC_1_N 
Orn/Lys/Arg decarboxylase, N-terminal domain
This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure.
PSSM-Id: 397666
Aligned: 81 rows
Threshold Bit Score: 63.4157
Threshold Setting Gi: 75363036
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q83W85               89 CFDSFDGNVHLIDC-CLYSVDEIVNKIQKIINDY 121 Escherichia coli
Q0I358               89 DFATIGHHVQFVDC-NLYTLDEIIHKIERAVEKY 121 Histophilus somni 129PT
KMZ32015             89 DYHKIGNHAQFIDC-NLYTQTEVISKIQKAIRQY 121 Haemophilus influenzae
ORU05682             94 NLRDFNLNINFLQYdALAGED--SDFIHKTITNY 125 Francisella tularensis subsp. holarctica
nankaitd:VCM66_0266 114 SLTDLRLNVHFFEY-ALGMADDIAIKINQATQEY 146 Vibrio cholerae M66-2
wugsc:ESA_03153      92 SANEMRMALWFFEY-SLGIADDIATRIRQYTQEY 124 Cronobacter sakazakii ATCC BAA-894
wugsc:KPN_00199     104 SSQDLRMTLWFFEY-ALGLSEEIATRIGQYTREY 136 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
WP_011816963         92 SLNEMRMALYFFEY-TLNAAEDIAQHIEQYTAEY 124 Yersinia enterocolitica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap