5Y4R,1AF7


Conserved Protein Domain Family
CheR_N

?
pfam03705: CheR_N 
Click on image for an interactive view with Cn3D
CheR methyltransferase, all-alpha domain
CheR proteins are part of the chemotaxis signaling mechanism in bacteria. CheR methylates the chemotaxis receptor at specific glutamate residues. CheR is an S-adenosylmethionine- dependent methyltransferase.
Statistics
?
PSSM-Id: 397663
Aligned: 696 rows
Threshold Bit Score: 29.7074
Threshold Setting Gi: 262078653
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y4R_B            26 ADFELFRVFLEKTCGIVLGSNKQYLVSSRLNKLMEQQGIKSLGELVQRIQTQR 78  Pseudomonas aeruginosa PAO1
jgi:Selin_1601    10 REFDLLRKFVYTNAGISLSDQKMALVQGRLSKRLRTLGMNSYKQYYDHLVSDd 62  Desulfurispirillum indicum S5
tigr:AHA_2532     17 GEFDLFRRFILNSAGIDLAPCKRALVQSRLAKRLRALHLTSYHAYWERINQSS 69  Aeromonas hydrophila subsp. hydrophila...
Q7NV39            11 AEFARFRQFILSEAGIDLPASKRSLVQSRLSKRLRHLGLDSYSAYWKLLSDPm 63  Chromobacterium violaceum
WP_014398298      19 SELEMFQHLVEAEAGIHLSPAKNALVANRLSRRLRELGLTSYAAYHAYVTTRG 71  Corallococcus coralloides
jgi:Anae109_0645  31 DEFELFQSLIHREAGIWLAPVKKALLVGRLARRLRELGMASYRAYHERVREDP 83  Anaeromyxobacter sp. Fw109-5
Q2INJ7            27 RDFLRFQALINREAGIWLAPVKKALLVGRLARRLRELGMHGYGEYFERVVEDG 79  Anaeromyxobacter dehalogenans 2CP-C
WP_013789283      12 IEFHQFRQLIHDIAGIHLSDAKKPLVAGRLNKRLRSLGMATYGEYFRLVGKDK 64  Pseudomonas fulva
WP_004327599       9 AEFEQFRALMHRAAGVDLPPQKISLVSGRLARRLRALGLASFGDYHRLVSSag 61  Thauera
WP_014780325       9 LEFAHFRKFIHGIAGIHLGPAKKTLVAGRLAKRLRFHGLASFGDYYRLLSADP 61  Thiocystis violascens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap